ARF(1-37)

General Information


DCTPep ID  DCTPep05158

Peptide Name   ARF(1-37)

Sequence  MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAP

Sequence Length  37

UniProt ID  Not available

PubChem CID  Not available

Origin  Protein derived

Type  Native peptide

Classification

  

Cancer targeted peptides Membrane-targeted Cell-penetrating peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Penetrating MCF-7 and MDA MB 231



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  fluorescein

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C197H326N64O42S2

Absent amino acids  DKNQSY

Theoretical pI  12.22

Acidic residues  1

Basic residues  9

Polar residues  5

Molecular weight (Average)  4327.28

Molecular weight (Monoisotopic)  4324.48

Common amino acids  R

Net charge  8

Instability index (II)  60.45

Aliphatic index  107.84

Grand average of hydropathicity (GRAVY)  0.238

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.271, assuming all pairs of Cys residues form cystines
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.271, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 17984975

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




Cppsite ID  1387

DCTPep is developed by Dr.Zheng's team.