This work is licensed under a Creative Commons Attribution 4.0 International License.
ARF(1-37)
General Information
DCTPep ID DCTPep05158
Peptide Name ARF(1-37)
Sequence MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAP
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Protein derived
Type Native peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating MCF-7 and MDA MB 231
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification fluorescein
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C197H326N64O42S2
Absent amino acids DKNQSY
Theoretical pI 12.22
Acidic residues 1
Basic residues 9
Polar residues 5
Molecular weight (Average) 4327.28
Molecular weight (Monoisotopic) 4324.48
Common amino acids R
Net charge 8
Instability index (II) 60.45
Aliphatic index 107.84
Grand average of hydropathicity (GRAVY) 0.238
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.271, assuming all pairs of Cys residues form cystines
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.271, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 17984975
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 1387
This work is licensed under a Creative Commons Attribution 4.0 International License.