Tat-PKI

General Information


DCTPep ID  DCTPep05318

Peptide Name   Tat-PKI

Sequence  GRKKRRQRRRPPQTYADFIASGRTGRRNAI

Sequence Length  30

UniProt ID  Not available

PubChem CID  Not available

Origin  Protein derived

Type  Native peptide

Classification

  

Cancer targeted peptides Membrane-targeted Cell-penetrating peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Penetrating CHO K1, HeLa, A549 cells



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

SequenceNo structure available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Rhodamine B

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  Not Applicable

Absent amino acids  Not Applicable

Theoretical pI  Not Applicable

Acidic residues  Not Applicable

Basic residues  Not Applicable

Polar residues  Not Applicable

Molecular weight (Average)  3570.09

Molecular weight (Monoisotopic)  3568.01

Common amino acids  Not Applicable

Net charge  Not Applicable

Instability index (II)  Not Applicable

Aliphatic index  Not Applicable

Grand average of hydropathicity (GRAVY)  Not Applicable

Half Life 
  Not Applicable

Extinction coefficients 
  Not Applicable

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 15937518

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




Cppsite ID  1806

DCTPep is developed by Dr.Zheng's team.