This work is licensed under a Creative Commons Attribution 4.0 International License.
KLA-Pen
General Information
DCTPep ID DCTPep05436
Peptide Name KLA-Pen
Sequence CRQIKIWFQNRRMKWKKKLAKLAKKLAKLAK
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Chimeric
Type Native peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating A549, the neuroblastoma cell line (SK-N-SH), SW480, U251, HEK-293 t, HaCaT, U88
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C179H309N55O35S2
Absent amino acids DEGHPSTVY
Theoretical pI 11.80
Acidic residues 0
Basic residues 13
Polar residues 2
Molecular weight (Average) 3855.89
Molecular weight (Monoisotopic) 3853.35
Common amino acids K
Net charge 13
Instability index (II) 17.94
Aliphatic index 88.39
Grand average of hydropathicity (GRAVY) -0.845
Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 11000
Abs 0.1% (=1 g/l) 2.853, assuming all pairs of Cys residues form cystines
Ext. coefficient 11000
Abs 0.1% (=1 g/l) 2.853, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24796502
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 2234
This work is licensed under a Creative Commons Attribution 4.0 International License.