This work is licensed under a Creative Commons Attribution 4.0 International License.
TP10-SRC1LXXLL
General Information
DCTPep ID DCTPep05462
Peptide Name TP10-SRC1LXXLL
Sequence PKKKRKVAGYLLGKINLKALAALAKKILPQMQQNVFQYPGAGMVPQGEANF
Sequence Length 51
UniProt ID Not available
PubChem CID Not available
Origin Chimeric
Type Native peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating MCF-7 cells
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C256H422N70O64S2
Absent amino acids CDHSTW
Theoretical pI 10.37
Acidic residues 1
Basic residues 9
Polar residues 10
Molecular weight (Average) 5568.72
Molecular weight (Monoisotopic) 5565.14
Common amino acids KA
Net charge 8
Instability index (II) 22.24
Aliphatic index 91.96
Grand average of hydropathicity (GRAVY) -0.231
Half Life
>20 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
? (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.535
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24705462
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 2264
This work is licensed under a Creative Commons Attribution 4.0 International License.