R7-SRC1LXXLL
General Information
DCTPep ID DCTPep05463
Peptide Name R7-SRC1LXXLL
Sequence PKKKRKVRRRRRRRYSQTSHKLVQLLTTAEQQ
Sequence Length 32
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating MCF-7 cells
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C172H307N67O45
Absent amino acids CDFGIMNW
Theoretical pI 12.23
Acidic residues 1
Basic residues 14
Polar residues 6
Molecular weight (Average) 4033.75
Molecular weight (Monoisotopic) 4031.38
Common amino acids R
Net charge 13
Instability index (II) 145.07
Aliphatic index 57.81
Grand average of hydropathicity (GRAVY) -1.913
Half Life
>20 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
? (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.369
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24705462
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 2265