This work is licensed under a Creative Commons Attribution 4.0 International License.
R7-SRC1(1222-1245)
General Information
DCTPep ID DCTPep05464
Peptide Name R7-SRC1(1222-1245)
Sequence PKKKRKVRRRRRRRPQMQQNVFQYPGAGMVPQGEANF
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating MCF-7, MDA-MB-231, and HeLa
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification NLS
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C194H324N72O48S2
Absent amino acids CDHILSTW
Theoretical pI 12.23
Acidic residues 1
Basic residues 12
Polar residues 6
Molecular weight (Average) 4497.28
Molecular weight (Monoisotopic) 4494.46
Common amino acids R
Net charge 11
Instability index (II) 126.02
Aliphatic index 28.92
Grand average of hydropathicity (GRAVY) -1.700
Half Life
>20 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
? (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.331
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24705462
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 2267
This work is licensed under a Creative Commons Attribution 4.0 International License.