b-WT1-pTj

General Information


DCTPep ID  DCTPep05493

Peptide Name   b-WT1-pTj

Sequence  CGGKDCERRFSRSDQLKRHQRRHTGVKPFQ

Sequence Length  30

UniProt ID  Not available

PubChem CID  Not available

Origin  Protein derived

Type  Native peptide

Classification

  

Cancer targeted peptides Membrane-targeted Cell-penetrating peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Penetrating A2058 human melanoma cells, B16F10-Nex2 syngeneic murine melanoma, HFF and MEF cells-- A2058 and SK-MEL-28, MCF-7 and MDA-MB231, OVCAR-3 and HL-61



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Biotinylation

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C150H246N58O43S2

Absent amino acids  AIMNWY

Theoretical pI  10.85

Acidic residues  3

Basic residues  11

Polar residues  8

Molecular weight (Average)  3614.09

Molecular weight (Monoisotopic)  3611.83

Common amino acids  R

Net charge  8

Instability index (II)  88.68

Aliphatic index  22.67

Grand average of hydropathicity (GRAVY)  -1.753

Half Life 
  1.2 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 125
  Abs 0.1% (=1 g/l) 0.035, assuming all pairs of Cys residues form cystines
  Ext. coefficient 0
  Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 24490140

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




Cppsite ID  2303

DCTPep is developed by Dr.Zheng's team.