b-WT1-pTj
General Information
DCTPep ID DCTPep05493
Peptide Name b-WT1-pTj
Sequence CGGKDCERRFSRSDQLKRHQRRHTGVKPFQ
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Protein derived
Type Native peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating A2058 human melanoma cells, B16F10-Nex2 syngeneic murine melanoma, HFF and MEF cells-- A2058 and SK-MEL-28, MCF-7 and MDA-MB231, OVCAR-3 and HL-61
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Biotinylation
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C150H246N58O43S2
Absent amino acids AIMNWY
Theoretical pI 10.85
Acidic residues 3
Basic residues 11
Polar residues 8
Molecular weight (Average) 3614.09
Molecular weight (Monoisotopic) 3611.83
Common amino acids R
Net charge 8
Instability index (II) 88.68
Aliphatic index 22.67
Grand average of hydropathicity (GRAVY) -1.753
Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 125
Abs 0.1% (=1 g/l) 0.035, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24490140
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 2303