pepR
General Information
DCTPep ID DCTPep05503
Peptide Name pepR
Sequence LKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating HepG2, BHK and HEK cell lineages, astrocytes and PBMC
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Rhodamine B
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula Not Applicable
Absent amino acids Not Applicable
Theoretical pI Not Applicable
Acidic residues Not Applicable
Basic residues Not Applicable
Polar residues Not Applicable
Molecular weight (Average) 4279.22
Molecular weight (Monoisotopic) 4276.58
Common amino acids Not Applicable
Net charge Not Applicable
Instability index (II) Not Applicable
Aliphatic index Not Applicable
Grand average of hydropathicity (GRAVY) Not Applicable
                    Half Life  
                      Not Applicable
                
                    Extinction coefficients  
                      Not Applicable
                
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24286593
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 2334