TMTP1-TAT-NBD

General Information


DCTPep ID  DCTPep05668

Peptide Name   TMTP1-TAT-NBD

Sequence  CGNVVRQGCGYGRKKRRQRRRGTALDWSWLQTE

Sequence Length  33

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer targeted peptides Membrane-targeted Cell-penetrating peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Penetrating PC- 3M-1E8, MDA-MB-231, MCF-7 and PC-3M-2B4 cells



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C165H270N62O46S2

Absent amino acids  FHIMP

Theoretical pI  11.30

Acidic residues  2

Basic residues  9

Polar residues  12

Molecular weight (Average)  3922.47

Molecular weight (Monoisotopic)  3920.01

Common amino acids  R

Net charge  7

Instability index (II)  89.91

Aliphatic index  44.24

Grand average of hydropathicity (GRAVY)  -1.358

Half Life 
  1.2 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 12615
  Abs 0.1% (=1 g/l) 3.216, assuming all pairs of Cys residues form cystines
  Ext. coefficient 12490
  Abs 0.1% (=1 g/l) 3.184, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 22580115

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




Cppsite ID  2714

DCTPep is developed by Dr.Zheng's team.