TMTP1-TAT-NBD
General Information
DCTPep ID DCTPep05668
Peptide Name TMTP1-TAT-NBD
Sequence CGNVVRQGCGYGRKKRRQRRRGTALDWSWLQTE
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating PC- 3M-1E8, MDA-MB-231, MCF-7 and PC-3M-2B4 cells
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C165H270N62O46S2
Absent amino acids FHIMP
Theoretical pI 11.30
Acidic residues 2
Basic residues 9
Polar residues 12
Molecular weight (Average) 3922.47
Molecular weight (Monoisotopic) 3920.01
Common amino acids R
Net charge 7
Instability index (II) 89.91
Aliphatic index 44.24
Grand average of hydropathicity (GRAVY) -1.358
Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 12615
Abs 0.1% (=1 g/l) 3.216, assuming all pairs of Cys residues form cystines
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 3.184, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 22580115
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 2714