This work is licensed under a Creative Commons Attribution 4.0 International License.
MG2A
General Information
DCTPep ID DCTPep05713
Peptide Name MG2A
Sequence GIGKFLHSAKKFGKAFVGEIMNSGGKKWKMRRNQFWVKVQRG
Sequence Length 42
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer targeted peptides Membrane-targeted Cell-penetrating peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Penetrating HeLa and A549 cells
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C222H351N67O51S2
Absent amino acids CDPTY
Theoretical pI 11.78
Acidic residues 1
Basic residues 12
Polar residues 11
Molecular weight (Average) 4838.77
Molecular weight (Monoisotopic) 4835.64
Common amino acids K
Net charge 11
Instability index (II) 17.59
Aliphatic index 53.33
Grand average of hydropathicity (GRAVY) -0.657
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 11000
Abs 0.1% (=1 g/l) 2.273
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 23286306
Title Not available
Doi Not available
Year Not available
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
Cppsite ID 2774
This work is licensed under a Creative Commons Attribution 4.0 International License.