This work is licensed under a Creative Commons Attribution 4.0 International License.
RT53
General Information
DCTPep ID DCTPep05895
Peptide Name RT53
Sequence RQIKIWFQNRRMKWKKAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKT
Sequence Length 53
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer targeted peptides Induce necrosis
Activity Information
Hemolytic Activity Mice red blood cells: 8% Hemolysis=20 μM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C306H503N93O69S1
Absent amino acids CHPS
Theoretical pI 11.67
Acidic residues 2
Basic residues 16
Polar residues 7
Molecular weight (Average) 6621
Molecular weight (Monoisotopic) 6616.84
Common amino acids K
Net charge 14
Instability index (II) 28.63
Aliphatic index 93.96
Grand average of hydropathicity (GRAVY) -0.777
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 13980
Abs 0.1% (=1 g/l) 2.111
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30080874
Title The anticancer peptide RT53 induces immunogenic cell death
Doi 10.1371/journal.pone.0201220
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.