RT53

General Information


DCTPep ID  DCTPep05895

Peptide Name   RT53

Sequence  RQIKIWFQNRRMKWKKAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKT

Sequence Length  53

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer targeted peptides Induce necrosis



Activity Information


Hemolytic Activity  Mice red blood cells: 8% Hemolysis=20 μM

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C306H503N93O69S1

Absent amino acids  CHPS

Theoretical pI  11.67

Acidic residues  2

Basic residues  16

Polar residues  7

Molecular weight (Average)  6621

Molecular weight (Monoisotopic)  6616.84

Common amino acids  K

Net charge  14

Instability index (II)  28.63

Aliphatic index  93.96

Grand average of hydropathicity (GRAVY)  -0.777

Half Life 
  1 hours (mammalian reticulocytes, in vitro).
  2 min (yeast, in vivo).
  2 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 13980
  Abs 0.1% (=1 g/l) 2.111

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 30080874

Title  The anticancer peptide RT53 induces immunogenic cell death

Doi 10.1371/journal.pone.0201220

Year  2018

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.