This work is licensed under a Creative Commons Attribution 4.0 International License.
MTX-GFLG-Melittin
General Information
DCTPep ID DCTPep06039
Peptide Name MTX-GFLG-Melittin
Sequence XGFLGGIGAVLKVLTTGLPALISWIKRKRQQ
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
ACP Tumor active peptide Targeted peptide conjugates
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| A20 | Mouse reticulum cell sarcoma | IC50=1.887±0.389μM | CCK-8 assay | 24h | Patent |
| HepG2 | Hepatoblastoma | IC50=2.241±0.941 μM | MTT assay | 24h | Patent |
| U937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | IC50=2.241±0.941μM | CCK-8 assay | 24h | Patent |
| Daudi | EBV-related Burkitt lymphoma | IC50=2.308±0.241μM | CCK-8 assay | 24h | Patent |
| ES-2 | Ovarian clear cell adenocarcinoma | IC50=2.570±0.658 μM | MTT assay | 24h | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification X=Methotrexate
Chiral L
Physicochemical Information
Formula Not Applicable
Absent amino acids Not Applicable
Theoretical pI Not Applicable
Acidic residues Not Applicable
Basic residues Not Applicable
Polar residues Not Applicable
Molecular weight (Average) Not Applicable
Molecular weight (Monoisotopic) Not Applicable
Common amino acids Not Applicable
Net charge Not Applicable
Instability index (II) Not Applicable
Aliphatic index Not Applicable
Grand average of hydropathicity (GRAVY) Not Applicable
Half Life
Not Applicable
Extinction coefficients
Not Applicable
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID CN115317622A
Patent Title Preparation and application of anti-tumor polypeptide coupling medicine
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.