SEQ ID NO: 3 of Patent CN113135987A
General Information
DCTPep ID DCTPep06050
Peptide Name SEQ ID NO: 3 of Patent CN113135987A
Sequence DPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIV
Sequence Length 40
UniProt ID Not available
PubChem CID Not available
Origin Synthetic (Derived from Caprin1)
Type Synthetic peptide
Classification
ACP Cancer targeted peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target G3BP1
Affinity Not available
Mechanism The compound can be competitively combined with the G3BP1 protein to specifically block the interaction between the Caprin1 and the G3BP1 protein and inhibit generation of stress particles so as to treat diseases related to the generation of SGs, such as tumors or neurodegenerative diseases.
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C204H323N57O64S3
Absent amino acids CHKW
Theoretical pI 4.17
Acidic residues 6
Basic residues 3
Polar residues 6
Molecular weight (Average) 4694.33
Molecular weight (Monoisotopic) 4691.29
Common amino acids Q
Net charge -3
Instability index (II) 39.7
Aliphatic index 85.25
Grand average of hydropathicity (GRAVY) -0.470
Half Life
1.1 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.317
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID CN113135987A
Patent Title Active peptide derived from Caprin1 and application thereof
Other Iinformation Not available
Other Published ID Not available