SEQ ID NO: 4 of Patent CN113135987A

General Information


DCTPep ID  DCTPep06051

Peptide Name   SEQ ID NO: 4 of Patent CN113135987A

Sequence  DLMAQMQGPYNPIQDSMLDPENQTLDPAIV

Sequence Length  30

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic (Derived from Caprin1)

Type  Synthetic peptide

Classification

  

ACP Cancer targeted peptides



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  G3BP1

Affinity  Not available

Mechanism  The compound can be competitively combined with the G3BP1 protein to specifically block the interaction between the Caprin1 and the G3BP1 protein and inhibit generation of stress particles so as to treat diseases related to the generation of SGs, such as tumors or neurodegenerative diseases.



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C143H226N36O50S3

Absent amino acids  CFHKRW

Theoretical pI  3.28

Acidic residues  5

Basic residues  0

Polar residues  6

Molecular weight (Average)  3345.76

Molecular weight (Monoisotopic)  3343.54

Common amino acids  DPQ

Net charge  -5

Instability index (II)  30.02

Aliphatic index  81.33

Grand average of hydropathicity (GRAVY)  -0.473

Half Life 
  1.1 hours (mammalian reticulocytes, in vitro).
  3 min (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.445

Amino acid distribution



Literature Information


Literature 1

Pubmed ID Not available

Title  Not available

Doi Not available

Year  Not available

Patent

Patent ID CN113135987A

Patent Title  Active peptide derived from Caprin1 and application thereof

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.