#2(D33-N52)

General Information


DCTPep ID  DCTPep06862

Peptide Name   #2(D33-N52)

Sequence  RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN

Sequence Length  30

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic (STAP-2 PH domain–derived peptide)

Type  Synthetic peptide

Classification

  

Cancer targeted peptides Coupling peptide



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  EGFR

Affinity  Not available

Mechanism  STAP-2 PH domain–derived peptide inhibited STAP-2–EGFR interaction and suppressed EGFR-mediated proliferation in several cancer cell lines.



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C172H270N62O41

Absent amino acids  CEHMPSV

Theoretical pI  11.72

Acidic residues  2

Basic residues  11

Polar residues  9

Molecular weight (Average)  3862.43

Molecular weight (Monoisotopic)  3860.09

Common amino acids  R

Net charge  9

Instability index (II)  158.81

Aliphatic index  42.33

Grand average of hydropathicity (GRAVY)  -1.663

Half Life 
  1 hours (mammalian reticulocytes, in vitro).
  2 min (yeast, in vivo).
  2 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 9970
  Abs 0.1% (=1 g/l) 2.581

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 36410436

Title  A peptide derived from adaptor protein STAP-2 inhibits tumor progression by downregulating epidermal growth factor receptor signaling

Doi 10.1016/j.jbc.2022.102724

Year  2023

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.