This work is licensed under a Creative Commons Attribution 4.0 International License.
#6(M108-L127)
General Information
DCTPep ID DCTPep06863
Peptide Name #6(M108-L127)
Sequence RRRRRRRRGGMWKGFILTVVELRVPTDLTL
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Synthetic (STAP-2 PH domain–derived peptide)
Type Synthetic peptide
Classification
Cancer targeted peptides Coupling peptide
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target EGFR
Affinity Not available
Mechanism STAP-2 PH domain–derived peptide inhibited STAP-2–EGFR interaction and suppressed EGFR-mediated proliferation in several cancer cell lines.
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C162H281N59O38S1
Absent amino acids ACHNQSY
Theoretical pI 12.30
Acidic residues 2
Basic residues 10
Polar residues 6
Molecular weight (Average) 3695.45
Molecular weight (Monoisotopic) 3693.16
Common amino acids R
Net charge 8
Instability index (II) 161.03
Aliphatic index 94.00
Grand average of hydropathicity (GRAVY) -0.673
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.488
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 36410436
Title A peptide derived from adaptor protein STAP-2 inhibits tumor progression by downregulating epidermal growth factor receptor signaling
Year 2023
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.