Peptide Libraray

General Information

DCTPep ID DCTPep06881

Peptide Name

Sequence TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC

Sequence Length 37

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
SNU449	Adult hepatocellular carcinoma	4.8% viability=162 μM	MTT assay	24h	1
SNU449	Adult hepatocellular carcinoma	52.8% viability=71 μM	MTT assay	24h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C180H302N52O55S4

Absent amino acids DFHP

Theoretical pI 9.30

Acidic residues 2

Basic residues 6

Polar residues 13

Molecular weight (Average) 4202.93

Molecular weight (Monoisotopic) 4200.13

Common amino acids K

Net charge 4

Instability index (II) 35.77

Aliphatic index 73.78

Grand average of hydropathicity (GRAVY) -0.405

Half Life
7.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 7115
Abs 0.1% (=1 g/l) 1.693, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.663, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 37495988

Title Characterization of a novel peptide mined from the Red Sea brine pools and modified to enhance its anticancer activity

Doi 10.1186/s12885-023-11045-4

Year 2023

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available