Dermaseptin-L1
General Information
DCTPep ID DCTPep00185
Peptide Name Dermaseptin-L1
Sequence GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS
Sequence Length 32
UniProt ID Not available
PubChem CID Not available
Origin skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| Hep-G2 | Hepatoblastoma; Hepatoblastoma | LC50=45 μM | Cytolytic assays | 1 h | 1 |
Hemolytic Activity Human erythrocytes: LC50=40 μM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Cytolytic
Structure Information
PDB ID Not available
Predicted Structure DCTPep00185
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C140H233N41O44
Absent amino acids CFHMRY
Theoretical pI 9.53
Acidic residues 2
Basic residues 4
Polar residues 9
Molecular weight (Average) 3194.64
Molecular weight (Monoisotopic) 3192.73
Common amino acids A
Net charge 2
Instability index (II) 13.5
Aliphatic index 88.75
Grand average of hydropathicity (GRAVY) -0.191
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.722
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 17561225
Title Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)
Doi 10.1016/j.toxicon.2007.04.017
Year 2007
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available