Peptide Libraray

Dermaseptin-L1

General Information

DCTPep ID DCTPep00185

Peptide Name Dermaseptin-L1

Sequence GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS

Sequence Length 32

UniProt ID Not available

PubChem CID Not available

Origin skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
Hep-G2	Hepatoblastoma; Hepatoblastoma	LC50=45 μM	Cytolytic assays	1 h	1

Hemolytic Activity Human erythrocytes: LC50=40 μM

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Cytolytic

Structure Information

PDB ID Not available

Predicted Structure DCTPep00185

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C140H233N41O44

Absent amino acids CFHMRY

Theoretical pI 9.53

Acidic residues 2

Basic residues 4

Polar residues 9

Molecular weight (Average) 3194.64

Molecular weight (Monoisotopic) 3192.73

Common amino acids A

Net charge 2

Instability index (II) 13.5

Aliphatic index 88.75

Grand average of hydropathicity (GRAVY) -0.191

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.722

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 17561225

Title Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)

Doi 10.1016/j.toxicon.2007.04.017

Year 2007

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available