This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00185 | Dermaseptin-L1 | GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS | 32 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DCTPep00186 | Phylloseptin-L1 | LLGMIPLAISAISALSKL | 18 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DCTPep00205 | Brevinin-1BLa | FLPAIVGAAAKFLPKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00206 | Brevinin-1BLc | FLPIIAGIAAKFLPKIFCTISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00207 | Brevinin-1Ya | FLPVIAGVAANFLPKLFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00208 | Brevinin-1Yb | FLPIIAGAAAKVVQKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00209 | Brevinin-1Yc | FLPIIAGAAAKVVEKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00210 | Ranatuerin-2Ya | GLMDTIKGVAKTVAASWLDKLKCKITGC | 28 | North America, leopard frog, Lithobates yavapaiensis |
| DCTPep00404 | Temporin-La | LLRHVVKILEKYL | 13 | Temporins family |
| DCTPep00405 | Temporin-Las | LLRHVVKILSKYL | 13 | Temporins family |
| DCTPep00406 | RGD-La | RGDLLRHVVKILEKYL | 16 | Arg-Gly-Asp(RGD) tripeptide ana temporins |
| DCTPep00407 | RGD-Las | RGDLLRHVVKILSKYL | 16 | Arg-Gly-Asp(RGD) tripeptide ana temporins |
| DCTPep00498 | T Peptide | TKPRKTKPRKTKPRKTKPR | 19 | Tuftsin derivative |
| DCTPep00577 | HPRP-A1 | FKKLKKLFSKLWNWK | 15 | Synthetic |
| DCTPep00578 | HPRP-A1-TAT | FKKLKKLFSKLWNWKRKKRRQRRR | 24 | Synthetic |
| DCTPep00583 | YR | YGFVMPRSGLWFR | 13 | Spirulina (Arthrospira) platensis |
| DCTPep00594 | ZXR-1 | FKIGGFIKKLWRSKLA | 16 | Synthetic |
| DCTPep00595 | ZXR-2 | FKIGGFIKKLWRSLLA | 16 | Synthetic |
| DCTPep00706 | FR-15 | FRRFFKWFRRFFKFF | 15 | AMP |
| DCTPep00707 | FR11P | FRRFFKWFRRPFKFF | 15 | AMP |
| DCTPep00708 | FR8P | FRRFFKWPRRFFKFF | 15 | AMP |
| DCTPep00709 | FR8, 11P | FRRFFKWPRRPFKFF | 15 | AMP |
| DCTPep00710 | FR4P | FRRPFKWFRRFFKFF | 15 | AMP |
| DCTPep00711 | FR4, 8P | FRRPFKWPRRFFKFF | 15 | AMP |
| DCTPep00723 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | 27 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00724 | Bombinin H-BO | IIGPVLGLIGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00802 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLA | 22 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00803 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00843 | I192F | GCRLYGFKFHGCG | 13 | Synthetic |
| DCTPep00844 | H193F | GCRLYGFKIFGCG | 13 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.