This work is licensed under a Creative Commons Attribution 4.0 International License.
Cupiennin-1a
General Information
DCTPep ID DCTPep00450
Peptide Name Cupiennin-1a
Sequence GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Cupiennius salei
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | EC50=0.15 µM | Alamar blue assay | 72h | 1 |
| Raji | EBV-related Burkitt lymphoma; Burkitt lymphoma | EC50=0.19 µM | Alamar blue assay | 72h | 1 |
| HL-60 | Adult acute myeloid leukemia; Acute myeloid leukemia | EC50=0.23 µM | Alamar blue assay | 72h | 1 |
| Sup T1 | EC50=0.23 µM | Alamar blue assay | 72h | 1 | |
| Molt-4 | Adult T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | EC50=0.33 µM | Alamar blue assay | 72h | 1 |
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | EC50=0.35 µM | Alamar blue assay | 72h | 1 |
Hemolytic Activity Human erythrocytes: 50% Hemolysis=7.8 µg/ml; 50% Cell death=23 µg/ml
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00450
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C176H289N47O44S1
Absent amino acids CDHIPRSW
Theoretical pI 10.30
Acidic residues 1
Basic residues 8
Polar residues 6
Molecular weight (Average) 3799.58
Molecular weight (Monoisotopic) 3797.15
Common amino acids K
Net charge 7
Instability index (II) 25.21
Aliphatic index 75.43
Grand average of hydropathicity (GRAVY) -0.131
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.392
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20140690
Title Cupiennin 1a exhibits a remarkably broad, non-stereospecific cytolytic activity on bacteria, protozoan parasites, insects, and human cancer cells
Year 2011
Literature 2
Pubmed ID 23523532
Title N-terminal aromatic residues closely impact the cytolytic activity of cupiennin 1a, a major spider venom peptide
Doi 10.1016/j.toxicon.2013.03.003
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.