This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00112 | V1 | CVKVKVKVGSGVKVKVKVC | 19 | Synthetic |
| DCTPep00113 | V2 | CVKVSVKVGSGVKVSVKVC | 19 | Synthetic |
| DCTPep00114 | V3 | CVKVRVKVGSGVKVRVKVC | 19 | Synthetic |
| DCTPep00115 | V4 | CVKVQVKVGSGVKVQVKVC | 19 | Synthetic |
| DCTPep00116 | V5 | CAKAKAKAGSGAKAKAKAC | 19 | Synthetic |
| DCTPep00117 | V6 | CFKFKFKFGSGFKFKFKFC | 19 | Synthetic |
| DCTPep00118 | V7 | CWKWKWKWGSGWKWKWKWC | 19 | Synthetic |
| DCTPep00450 | Cupiennin-1a | GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME | 35 | Cupiennius salei |
| DCTPep00509 | 3-OH-C16-KKKK | KKKK | 4 | Synthetic |
| DCTPep00510 | C16-KKKK | KKKK | 4 | Synthetic |
| DCTPep00558 | Callyaerin C | HXLLPPVXPLFG | 12 | Callyspongia aerizusa |
| DCTPep00559 | Callyaerin B | IXIILPPLXPII | 12 | Callyspongia aerizusa |
| DCTPep00560 | Callyaerin A | IXVILPPLXPIFG | 13 | Callyspongia aerizusa |
| DCTPep00581 | Ctn[1-14] | KRFKKFFKKVKKSV | 14 | Rattlesnake Venom Cathelicidin |
| DCTPep00582 | Ctn(Crotalicidin) | KRFKKFFKKVKKSVKKRLKKå·¥FKKPMVIGVTIPF | 34 | Rattlesnake Venom Cathelicidin |
| DCTPep00671 | Temporin-1Sa [L2,9A;V6A] | FASGIAGMAGKLF | 13 | Synthetic |
| DCTPep00672 | ABP-dHC-CecropinA-K(24) | RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK | 37 | ABP-dHC-Cecropin A and its analog |
| DCTPep00673 | ABP-dHC-CecropinA | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK | 37 | ABP-dHC-Cecropin A and its analog |
| DCTPep00798 | HlDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | 37 | Synthetic |
| DCTPep00799 | HlDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCY | 36 | Synthetic |
| DCTPep00924 | Cm-p5 [E4C, H8C] | SRSCLIVCQRLF | 12 | Synthetic |
| DCTPep01019 | Temporin-SHe | FLPALAGIAGLLGKIF | 16 | Pelophylax saharicus |
| DCTPep02219 | PL-D 1 | WKWLKKWIK | 9 | Synthetic |
| DCTPep02220 | PL-D 2 | ILRWKWRWWRWRR | 13 | Synthetic |
| DCTPep02221 | PL-D 3 | ILPWKWRWWKWRR | 13 | Synthetic |
| DCTPep02222 | PL-D 4 | RWRRKWWWW | 9 | Synthetic |
| DCTPep02223 | PL-D 5 | WRKFWKYLK | 9 | Synthetic |
| DCTPep02224 | PL-D 6 | KRWWKWWRR | 9 | Synthetic |
| DCTPep02225 | PL-D 7 | RRWWKWWWR | 9 | Synthetic |
| DCTPep02226 | PL-D 8 | KIWWWWRKR | 9 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.