This work is licensed under a Creative Commons Attribution 4.0 International License.
LL 37
General Information
DCTPep ID DCTPep00494
Peptide Name LL 37
Sequence [LL-37, 37 aa]
Sequence Length 37
PubChem CID 16198951
Origin Also known human cathelicidin
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| MCF-7 | Invasive breast carcinoma of no special type | LC50=21 at 100 µM | MTS assay | 72 h | 1 |
| OVCAR-3 | High grade ovarian serous adenocarcinoma | LC50=24 at 100 µM | MTS assay | 72 h | 1 |
| LNCaP | Prostate carcinoma | LC50=27 at 100 µM | MTS assay | 72 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Primary dermal fibroblast: LC50=26 at 100 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 2K6O
Predicted Structure DCTPep00494
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C205H340N60O53
Absent amino acids ACHMWY
Theoretical pI 10.61
Acidic residues 5
Basic residues 11
Polar residues 6
Molecular weight (Average) 4493.32
Molecular weight (Monoisotopic) 4490.58
Common amino acids K
Net charge 6
Instability index (II) 23.34
Aliphatic index 89.46
Grand average of hydropathicity (GRAVY) -0.724
Half Life
5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24587350
Title Learning from host-defense peptides: cationic, amphipathic peptoids with potent anticancer activity
Doi 10.1371/journal.pone.0090397
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
This work is licensed under a Creative Commons Attribution 4.0 International License.