This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00197 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | 21 | Histone H2A |
| DCTPep00266 | Pexiganan MSI-78 | GIGKFLKKAKKFGKAFVKILKK | 22 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DCTPep00494 | LL 37 | [LL-37, 37 aa] | 37 | Also known human cathelicidin |
| DCTPep01035 | MAD1 | KRWHWWRRHWVVW | 13 | Synthetic |
| DCTPep01036 | AMP2 | KRWWKWWRR | 9 | Synthetic |
| DCTPep01037 | DAP1 | LWKRWVGVWRKWL | 13 | Synthetic |
| DCTPep01038 | DAP2 | RWGKWFKKNSHLS | 13 | Synthetic |
| DCTPep01039 | AMP1 | WKWLKKWIK | 9 | Synthetic |
| DCTPep02939 | Phakellistatin 5 | AIPFNAM | 7 | Phakellia costada |
This work is licensed under a Creative Commons Attribution 4.0 International License.