ABP-dHC-CecropinA
General Information
DCTPep ID DCTPep00673
Peptide Name ABP-dHC-CecropinA
Sequence RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK
Sequence Length 37
UniProt ID P50720
PubChem CID Not available
Origin ABP-dHC-Cecropin A and its analog
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | IC50=228.5 µM | MTT assay | 24h | 1 |
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | IC50=303.2 µM | MTT assay | 24h | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | IC50=349.5 µM | MTT assay | 24h | 1 |
Hemolytic Activity Human red blood cells (hRBCs): only 3% hemolysis was observed at the concentration of 800 µM
Normal (non-cancerous) Cytotoxicity HEK-293, PBMCs: no cytotoxicity toward HEK-293 cells or PBMCs, even at the highest concentration of 640 µM.
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00673
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C185H316N56O46
Absent amino acids CHMSY
Theoretical pI 11.17
Acidic residues 2
Basic residues 9
Polar residues 7
Molecular weight (Average) 4060.89
Molecular weight (Monoisotopic) 4058.41
Common amino acids K
Net charge 7
Instability index (II) 20.13
Aliphatic index 108.11
Grand average of hydropathicity (GRAVY) -0.186
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.354
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28347740
Title Selective cytotoxicity of the antibacterial peptide ABP-dHC-Cecropin A and its analog towards leukemia cells
Doi 10.1016/j.ejphar.2017.03.054
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available