This work is licensed under a Creative Commons Attribution 4.0 International License.
HlDFS2
General Information
DCTPep ID DCTPep00799
Peptide Name HlDFS2
Sequence GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCY
Sequence Length 36
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Not active up to 20 µM | Cell Viability Assay | 24h | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL30 positive; Chronic myeloid leukemia | Not active up to 20 µM | Cell Viability Assay | 24h | 1 |
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | Not active up to 20 µM | Cell Viability Assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: <5% Hemolysis=50µM
Normal (non-cancerous) Cytotoxicity HEK293T: Not active up to 20 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00799
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys25; Cys11<--->Cys33; Cys15<--->Cys35
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C165H265N59O46S6
Absent amino acids DEMVW
Theoretical pI 9.43
Acidic residues 0
Basic residues 8
Polar residues 19
Molecular weight (Average) 4003.65
Molecular weight (Monoisotopic) 4000.85
Common amino acids CG
Net charge 8
Instability index (II) 90.89
Aliphatic index 46.11
Grand average of hydropathicity (GRAVY) -0.444
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 3355
Abs 0.1% (=1 g/l) 0.838, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.744, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28969703
Title Functional characterization of two defensins, HlDFS1 and HlDFS2, from the hard tick Haemaphysalis longicornis
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.