RN3(5-17P22-36)[T4I]
General Information
DCTPep ID DCTPep02000
Peptide Name RN3(5-17P22-36)[T4I]
Sequence RPFIRAQWFAIQHISPRTIAMRAINNYRWR
Sequence Length 30
UniProt ID P12724
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
ACP Tumor active peptide Membrane-targeted
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| Hep-G2 | Hepatoblastoma | IC50=95.78±6.37 µM | MTT assay | 4 h | 1 |
Hemolytic Activity Sheep erythrocytes:50% Hemolysis>150 µM
Normal (non-cancerous) Cytotoxicity MRC-5: IC50>150 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02000
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C173H266N56O38S1
Absent amino acids CDEGKLV
Theoretical pI 12.30
Acidic residues 0
Basic residues 7
Polar residues 5
Molecular weight (Average) 3770.43
Molecular weight (Monoisotopic) 3768.03
Common amino acids R
Net charge 7
Instability index (II) 60.23
Aliphatic index 78.33
Grand average of hydropathicity (GRAVY) -0.493
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 3.313
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29763807
Title Positional scanning library applied to the human eosinophil cationic protein/RNase3 N-terminus reveals novel and potent anti-biofilm peptides
Doi 10.1016/j.ejmech.2018.05.012
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_14141