Peptide Libraray

RN3(5-17P22-36)[Q12I]

General Information

DCTPep ID DCTPep02002

Peptide Name RN3(5-17P22-36)[Q12I]

Sequence RPFTRAQWFAIIHISPRTIAMRAINNYRWR

Sequence Length 30

UniProt ID P12724

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

ACP Tumor active peptide Membrane-targeted

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
Hep-G2	Hepatoblastoma	IC50=59.64±6.17 µM	MTT assay	4 h	1

Hemolytic Activity Sheep erythrocytes: 50% Hemolysis>100µM

Normal (non-cancerous) Cytotoxicity MRC-5: IC50>100 µM

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep02002

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C172H265N55O38S1

Absent amino acids CDEGKLV

Theoretical pI 12.30

Acidic residues 0

Basic residues 7

Polar residues 6

Molecular weight (Average) 3743.4

Molecular weight (Monoisotopic) 3741.02

Common amino acids R

Net charge 7

Instability index (II) 64.34

Aliphatic index 78.33

Grand average of hydropathicity (GRAVY) -0.400

Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 12490
Abs 0.1% (=1 g/l) 3.337

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 29763807

Title Positional scanning library applied to the human eosinophil cationic protein/RNase3 N-terminus reveals novel and potent anti-biofilm peptides

Doi 10.1016/j.ejmech.2018.05.012

Year 2018

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID DBAASPS_14143