This work is licensed under a Creative Commons Attribution 4.0 International License.
ABP-CM4
General Information
DCTPep ID DCTPep02276
Peptide Name ABP-CM4
Sequence RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI
Sequence Length 35
UniProt ID P14666
PubChem CID Not available
Origin Bombyx mori
Type Native peptide
Classification
ACP Tumor active peptide Membrane lysis
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | IC50=14.2 µM | MTT assay | 24 h | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | IC50=15.8 µM | MTT assay | 24 h | 1 |
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | IC50=17.5 µM | MTT assay | 24 h | 1 |
Hemolytic Activity Human erythrocytes: Not active up to 200 µM
Normal (non-cancerous) Cytotoxicity HEK293: Not active up to 80 µM; Human PBMC: Not active up to 80 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02276
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C172H290N50O44
Absent amino acids CHLMSY
Theoretical pI 10.56
Acidic residues 2
Basic residues 7
Polar residues 6
Molecular weight (Average) 3762.5
Molecular weight (Monoisotopic) 3760.2
Common amino acids AIKV
Net charge 5
Instability index (II) 34.59
Aliphatic index 111.43
Grand average of hydropathicity (GRAVY) 0.129
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.462
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20493915
Title A cationic amphiphilic peptide ABP-CM4 exhibits selective cytotoxicity against leukemia cells
Doi 10.1016/j.peptides.2010.05.010
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_3460
This work is licensed under a Creative Commons Attribution 4.0 International License.