This work is licensed under a Creative Commons Attribution 4.0 International License.
CEN1 HC (Ser)
General Information
DCTPep ID DCTPep02888
Peptide Name CEN1 HC (Ser)
Sequence GWFKKTFHKVSHAVKSGIHAGQRGSSALGF
Sequence Length 30
UniProt ID D8WN02
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | Weak active up to 125 mg/L | MTT assay | 6 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep02888
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C148H225N45O37
Absent amino acids CDEMNPY
Theoretical pI 11.33
Acidic residues 0
Basic residues 8
Polar residues 10
Molecular weight (Average) 3226.69
Molecular weight (Monoisotopic) 3224.71
Common amino acids G
Net charge 8
Instability index (II) 21.86
Aliphatic index 55.33
Grand average of hydropathicity (GRAVY) -0.317
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.705
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 23237525
Title Anti-infectious and anti-inflammatory effects of peptide fragments sequentially derived from the antimicrobial peptide centrocin 1 isolated from the green sea urchin, Strongylocentrotus droebachiensis
Year 2012
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPS_17827
This work is licensed under a Creative Commons Attribution 4.0 International License.