This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep06796 | SEQ ID NO: 513 of Patent CN110785183A | KLVELEHTL | 9 | Synthetic |
| DCTPep06797 | SEQ ID NO: 514 of Patent CN110785183A | VQLDSIEDLEV | 11 | Synthetic |
| DCTPep06798 | SEQ ID NO: 515 of Patent CN110785183A | KIFEMLEGV | 9 | Synthetic |
| DCTPep06799 | SEQ ID NO: 516 of Patent CN110785183A | YTFSGDVQL | 9 | Synthetic |
| DCTPep06800 | SEQ ID NO: 517 of Patent CN110785183A | TLYNPERTITV | 11 | Synthetic |
| DCTPep06801 | SEQ ID NO: 518 of Patent CN110785183A | GLLEDERALQL | 11 | Synthetic |
| DCTPep06802 | SEQ ID NO: 519 of Patent CN110785183A | KIQEILTQV | 9 | Synthetic |
| DCTPep06803 | SEQ ID NO: 520 of Patent CN110785183A | KIQEMQHFL | 9 | Synthetic |
| DCTPep06804 | SEQ ID NO: 521 of Patent CN110785183A | FVYGEPREL | 9 | Synthetic |
| DCTPep06805 | SEQ ID NO: 522 of Patent CN110785183A | TLDEKVAEL | 9 | Synthetic |
| DCTPep06806 | SEQ ID NO: 523 of Patent CN110785183A | HLIAEIHTA | 9 | Synthetic |
| DCTPep06807 | SEQ ID NO: 524 of Patent CN110785183A | KVWSDVTPL | 9 | Synthetic |
| DCTPep06808 | SEQ ID NO: 525 of Patent CN110785183A | RLDDLKMTV | 9 | Synthetic |
| DCTPep06809 | SEQ ID NO: 526 of Patent CN110785183A | VLSPFILTL | 9 | Synthetic |
| DCTPep06810 | SEQ ID NO: 527 of Patent CN110785183A | LLDSVSRL | 8 | Synthetic |
| DCTPep06811 | SEQ ID NO: 528 of Patent CN110785183A | RLLDSVSRL | 9 | Synthetic |
| DCTPep06812 | SEQ ID NO: 529 of Patent CN110785183A | HPSAHDVIL | 9 | Synthetic |
| DCTPep06813 | SEQ ID NO: 530 of Patent CN110785183A | APAAWLRSAA | 10 | Synthetic |
| DCTPep06830 | CD9-BP | RSHRLRLH | 8 | EWI-2 protein |
| DCTPep06862 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06863 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06864 | 2A(F39-Q58) | RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06865 | 2C(Q44-Q58) | RRRRRRRRGGQGLTIYFYNSNRDFQ | 25 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06866 | 2D(Q44-R55) | RRRRRRRRGGQGLTIYFYNSNR | 22 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06867 | 2D2(Q44-Y51) | RRRRRRRRGGQGLTIYFY | 18 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06868 | 2D3(G45-N52) | RRRRRRRRGGGLTIYFYN | 18 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06869 | 2D5(G45-Y51) | RRRRRRRRGGGLTIYFY | 17 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06870 | 6E(V116-M135) | RRRRRRRRGGVVELRVPTDLTLLPGHLYMM | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06871 | 6F (I113-P122) | RRRRRRRRGGILTVVELRVP | 20 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06872 | IWDTIEK | 7 | Snake venom of N. kaouthia |
This work is licensed under a Creative Commons Attribution 4.0 International License.