This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00188 | vibi G | GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN | 31 | V. biflora |
| DCTPep00189 | vibi H | GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN | 31 | V. biflora |
| DCTPep00190 | vibi E | GIPCAESCVWIPCTVTALIGCGCSNKVCYN | 30 | V. biflora |
| DCTPep00191 | vibi D | GLPVCGETCFGGRCNTPGCTCSYPICTRN | 29 | V. biflora |
| DCTPep00279 | Vaby A(1) | GLPVCGETCAGGTCNTPGCSCSWPICTRN | 29 | Viola abyssinica of the Ethiopian Highlands |
| DCTPep00280 | Vaby D(4) | GLPVCGETCFGGTCNTPGCTCDPWPVCTRN | 30 | Viola abyssinica of the Ethiopian Highlands |
This work is licensed under a Creative Commons Attribution 4.0 International License.