This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01828 | MB30 | GQVWEATATVNAIRGSVTPAVSQFNARTAD | 30 | Derived from the MPT63 secreted protein |
| DCTPep01829 | TG20 | NHFTLKCPKTALTEPPTLAY | 20 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
| DCTPep01830 | TG23 | TAGIKLTVPIEKFPVTTQTFWG | 22 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
This work is licensed under a Creative Commons Attribution 4.0 International License.