This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01130 | CMAP-L-23 | KKFFKKMKSFFKKFF | 15 | Not available |
| DCTPep01131 | CMAP-L-232 | KKFFKKMSFFFFKKK | 15 | Not available |
| DCTPep01132 | CMAP-L-241 | KKFFKLVKKKMKKFF | 15 | Not available |
| DCTPep01133 | CMAP-L-20 | KKFFSKMKSFFKKFF | 15 | Not available |
| DCTPep01134 | CMAP-L-202 | KKFFSKSMKSFFFFKK | 16 | Not available |
| DCTPep01135 | CMAP-L-253 | KKKKFFMFVFFKKKK | 15 | Not available |
| DCTPep01136 | CMAP-L-243 | KKKKFFMLVKKKKFF | 15 | Not available |
| DCTPep01137 | CMAP-L-233 | KKKKFFMSFFFKKKF | 15 | Not available |
| DCTPep01138 | CMAP-L-201 | KKKKFFSMSFFKKFF | 15 | Not available |
| DCTPep01139 | CB1a, Cecropin-B1a | KWKVFKKIEKKWKVFKKIEKAGPKWKVFKKIEK | 33 | Not available |
| DCTPep01140 | ALT614 | MADIKQEHDTELDQNYSLGSNTDPKNMQELTQYVQTLLQSVQDKFQTMSDQILNRIDEMGSRIDDLEKNISDLMTQAGVEGPDK | 84 | Antlion |
| DCTPep01141 | SEQ ID NO 19 from EP1783140A3 | ADGAPRPGAPLA | 12 | Screen of phage display peptide library |
| DCTPep01142 | SEQ ID NO 17 from EP1783140A3 | APRPG | 5 | Screen of phage display peptide library |
| DCTPep01143 | SEQ ID NO 6 from EP1783140A3 | ASSSYPLIHWRPWAR | 15 | Screen of phage display peptide library |
| DCTPep01144 | SEQ ID NO 13 from EP1783140A3 | DRWRPALP | 8 | Screen of phage display peptide library |
| DCTPep01145 | SEQ ID NO 5 from EP1783140A3 | DRWRPALPVVLFPLH | 15 | Screen of phage display peptide library |
| DCTPep01146 | SEQ ID NO 33 from EP1783140A3 | HARPW | 5 | Screen of phage display peptide library |
| DCTPep01147 | SEQ ID NO 34 from EP1783140A3 | HWAPW | 5 | Screen of phage display peptide library |
| DCTPep01148 | SEQ ID NO 35 from EP1783140A3 | HWRAW | 5 | Screen of phage display peptide library |
| DCTPep01149 | SEQ ID NO 29 from EP1783140A3 | HWRP | 4 | Screen of phage display peptide library |
| DCTPep01150 | SEQ ID NO 16 from EP1783140A3 | HWRPW | 5 | Screen of phage display peptide library |
| DCTPep01151 | SEQ ID NO 14 from EP1783140A3 | IHWRPWAR | 8 | Screen of phage display peptide library |
| DCTPep01152 | SEQ ID NO 24 from EP1783140A3 | LFPLH | 5 | Screen of phage display peptide library |
| DCTPep01153 | SEQ ID NO 21 from EP1783140A3 | PVVLFLH | 7 | Screen of phage display peptide library |
| DCTPep01154 | SEQ ID NO 28 from EP1783140A3 | RWRP | 4 | Screen of phage display peptide library |
| DCTPep01155 | SEQ ID NO 32 from EP1783140A3 | WRP | 3 | Screen of phage display peptide library |
| DCTPep01156 | SEQ ID NO 30 from EP1783140A3 | WRPA | 4 | Screen of phage display peptide library |
| DCTPep01157 | SEQ ID NO 31 from EP1783140A3 | WRPW | 4 | Screen of phage display peptide library |
| DCTPep01158 | SEQ ID NO: 2 from EP2716297B1 | LNQEDARKSE | 10 | Screen of phage display peptide library |
| DCTPep01159 | SEQ ID NO: 3 from EP2716297B1 | LNQEEARKSE | 10 | Screen of phage display peptide library |
This work is licensed under a Creative Commons Attribution 4.0 International License.