| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00119 | CIGB-300 (P15-Tat) | CWMSPRHLGTCGRKKRRQRRRPPQ | 24 | Synthetic |
| DCTPep00514 | Mastoparan | INLKALAALAKKIL | 14 | Vespula lewisii |
| DCTPep01828 | MB30 | GQVWEATATVNAIRGSVTPAVSQFNARTAD | 30 | Derived from the MPT63 secreted protein |
| DCTPep01829 | TG20 | NHFTLKCPKTALTEPPTLAY | 20 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
| DCTPep01830 | TG23 | TAGIKLTVPIEKFPVTTQTFWG | 22 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |