This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00185 | Dermaseptin-L1 | GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS | 32 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DCTPep00186 | Phylloseptin-L1 | LLGMIPLAISAISALSKL | 18 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DCTPep00205 | Brevinin-1BLa | FLPAIVGAAAKFLPKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00206 | Brevinin-1BLc | FLPIIAGIAAKFLPKIFCTISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00207 | Brevinin-1Ya | FLPVIAGVAANFLPKLFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00208 | Brevinin-1Yb | FLPIIAGAAAKVVQKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00209 | Brevinin-1Yc | FLPIIAGAAAKVVEKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DCTPep00210 | Ranatuerin-2Ya | GLMDTIKGVAKTVAASWLDKLKCKITGC | 28 | North America, leopard frog, Lithobates yavapaiensis |
This work is licensed under a Creative Commons Attribution 4.0 International License.