This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01735 | SB-37 AM | MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG | 38 | FLAK peptides |
| DCTPep01739 | FLAK26V AM | VAKKLAKLAKKLAKLAL | 17 | FLAK peptides |
| DCTPep01743 | FLAK50V | VAKLLAKLAKKLL | 13 | FLAK peptides |
| DCTPep01744 | FLAK50T8 | VAKLLAKLAKKVL | 13 | FLAK peptides |
| DCTPep01748 | FLAK-120G | VALALKALKKL | 11 | FLAK peptides |
| DCTPep01750 | FLAK-120F | WALAL | 5 | FLAK peptides |
| DCTPep01751 | FLAK50T9 | YAKLLAKLAKKAL | 13 | FLAK peptides |
| DCTPep02008 | HAL-2/6 | GKWMSFLKHILK | 12 | Synthetic |
| DCTPep02009 | HAL-2 | GKWMSLLKHILK | 12 | Halictines and their analogs |
| DCTPep02010 | HAL-2/22 | gkwmsllkhilk | 12 | Synthetic |
| DCTPep02011 | HAL-2/8 | GKwMSLLKHILK | 12 | Synthetic |
| DCTPep02012 | HAL-2/18 | GKWMSLLKHIWK | 12 | Synthetic |
| DCTPep02013 | HAL-2/19 | GKWMSLLKHWLK | 12 | Synthetic |
| DCTPep02014 | HAL-2/4 | GKWMSLLKKILK | 12 | Synthetic |
| DCTPep02015 | HAL-2/20 | GKWMSLWKHILK | 12 | Synthetic |
| DCTPep02016 | HAL-2/13 | GKWMTLLKHILK | 12 | Synthetic |
| DCTPep02017 | HAL-1/12 | GKWSKILGHLIR | 12 | Synthetic |
| DCTPep02018 | HAL-1/20 | GKWSKILGKLIR | 12 | Synthetic |
| DCTPep02019 | HAL-1/5 | GMWKKILGHLIR | 12 | Synthetic |
| DCTPep02020 | HAL-1/10 | GMWKKILGKLIR | 12 | Synthetic |
| DCTPep02021 | HAL-1/6 | GMWSKILGHLIk | 12 | Synthetic |
| DCTPep02022 | HAL-1 | GMWSKILGHLIR | 12 | Halictines and their analogs |
| DCTPep02023 | HAL-1/22 | gmwskilghlir | 12 | Synthetic |
| DCTPep02026 | HAL-1/9 | GMWSKILGKLIR | 12 | Synthetic |
| DCTPep02027 | HAL-1/18 | GMWSKILKHLIR | 12 | Synthetic |
| DCTPep02325 | m2163 | KRKCPKTPFDNTPGAWFAHLILGC | 24 | Lactobacillus casei; Lactobacillus paracasei |
| DCTPep02326 | m2386 | DSIRDVSPTFNKIRRWFDGLFK | 22 | Lactobacillus casei; Lactobacillus paracasei |
This work is licensed under a Creative Commons Attribution 4.0 International License.