This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00371 | LL-III/19 | VNWKKXLGKXIKXVK | 15 | Synthetic |
| DCTPep00372 | LL-III/11 | VNWKKIILGKIIKVVK | 16 | Synthetic |
| DCTPep00373 | LL-III/1 | VNWKKILAKIIKVVK | 15 | Synthetic |
| DCTPep00375 | LL-III | VNWKKILGKIIKVVK | 15 | Lasioglossin III and its analogs |
| DCTPep00376 | LL-III/12 | vnwkkilgkiikvvk | 15 | Synthetic |
| DCTPep00377 | LL-III/37 | VNWKKVLAKIIKVVK | 15 | Synthetic |
| DCTPep00378 | LL-III/8 | VNWKKILGKIIKVVK | 15 | Synthetic |
| DCTPep00379 | LL-III/9 | VNWKKILGKIIKVVK | 15 | Synthetic |
| DCTPep00380 | LL-III/4 | VNWKKILGKIKKVVK | 15 | Synthetic |
| DCTPep00382 | LL-III/6 | VNWKKILPKIIKVVK | 15 | Synthetic |
| DCTPep00383 | LL-III/23 | VNWKKLLGKLLKVVK | 15 | Synthetic |
| DCTPep00385 | LL-III/25 | vnwkkllgkllkvvk | 15 | Synthetic |
| DCTPep00386 | LL-III/27 | VNWKKVLGKVVKVVK | 15 | Synthetic |
| DCTPep00387 | LL-III/24 | VNWXXILGXIIXVVX | 15 | Synthetic |
| DCTPep00388 | LL-III/17 | VNWRRILGRIIRVVR | 15 | Synthetic |
| DCTPep00390 | LL-III/26 | VYWKKILGKIIKVVK | 15 | Synthetic |
| DCTPep00391 | SVS-1 | KVKVKVKVpPTKVKVKVK | 18 | Synthetic |
| DCTPep00392 | SVS-2 | kvkvkvkvPptkvkvkvk | 18 | Synthetic |
| DCTPep00394 | Chassatide C8 | AIPCGESCVWIPCISTVIGCSCSNKVCYR | 29 | Chassalia chartacea |
| DCTPep00395 | Chassatide C4 | GASCGETCFTGICFTAGCSCNPWPTCTRN | 29 | Chassalia chartacea |
| DCTPep00396 | Chassatide C10 | GEYCGESCYLIPCFTPGCYCVSRQCVNKN | 29 | Chassalia chartacea |
| DCTPep00397 | Chassatide C2 | GIPCAESCVWIPCTITALMGCSCKNNVCYNN | 31 | Chassalia chartacea |
| DCTPep00399 | Chassatide C1 | GDACGETCFTGICFTAGCSCNPWPTCTRN | 29 | Chassalia chartacea |
| DCTPep00400 | Chassatide C11 | IPCGESCVWIPCISGMFGCSCKDKVCYS | 28 | Chassalia chartacea |
| DCTPep00402 | Chassatide C7 | IPCGESCVWIPCITAIAGCSCKNKVCYT | 28 | Chassalia chartacea |
| DCTPep00403 | P7 | PLLQATLGGGS | 11 | No information found in the references |
| DCTPep00404 | Temporin-La | LLRHVVKILEKYL | 13 | Temporins family |
| DCTPep00405 | Temporin-Las | LLRHVVKILSKYL | 13 | Temporins family |
| DCTPep00406 | RGD-La | RGDLLRHVVKILEKYL | 16 | Arg-Gly-Asp(RGD) tripeptide ana temporins |
| DCTPep00407 | RGD-Las | RGDLLRHVVKILSKYL | 16 | Arg-Gly-Asp(RGD) tripeptide ana temporins |
This work is licensed under a Creative Commons Attribution 4.0 International License.