This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00918 | [G18K]cTI | KWCFRVCYRGICYRRCRK | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00919 | [R17S]cTI | KWCFRVCYRGICYRRCSG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00920 | [R14S]cTI | KWCFRVCYRGICYSRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00921 | [R9S]cTI | KWCFRVCYSGICYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00922 | [R9S-R14S-R17S]cTI | KWCFRVCYSGICYSRCSG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00923 | [F4S-Y13S]cTI | KWCSRVCYRGICSRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00939 | Turgencin B | GIKEMLCNMACAQTVCKKSGGPLCDTCQAACKALG | 35 | Synoicum turgens |
| DCTPep00940 | Turgencin B Mox1 | GIKEXLCNMACAQTVCKKSGGPLCDTCQAACKALG | 35 | Synoicum turgens |
| DCTPep00942 | Turgencin A | GPKTKAACKXACKLATCGKKPGGWKCKLCELGCDAV | 36 | Synoicum turgens |
| DCTPep00943 | Indolicidin-Lys | ILPWKWPWWPWKK | 13 | porcine cathelicidin peptide |
| DCTPep00944 | Indolicidin-Arg | ILPWKWPWWPWRR | 13 | porcine cathelicidin peptide |
| DCTPep00948 | BP329 | CREKAKKLFKKILKKL | 16 | Synthetic |
| DCTPep00949 | Tritrp-Agb | VXXFPWWWPFLXX | 13 | porcine cathelicidin peptide |
| DCTPep00952 | Tritrp-hArg | VXXFPWWWPFLXX | 13 | porcine cathelicidin peptide |
| DCTPep00953 | Tritrp-P59A-Lys | VKKFAWWWAFLKK | 13 | porcine cathelicidin peptide |
| DCTPep00954 | Tritrp-P5A-Lys | VKKFAWWWPFLKK | 13 | porcine cathelicidin peptide |
| DCTPep00955 | Tritrp-P9A-Lys | VKKFPWWWAFLKK | 13 | porcine cathelicidin peptide |
| DCTPep00956 | Tritrp-Lys | VKKFPWWWPFLKK | 13 | porcine cathelicidin peptide |
| DCTPep00958 | Tritrp-P59A | VRRFAWWWAFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00959 | Tritrp-P5A | VRRFAWWWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00960 | Tritrp-W678bTA | VRRFPXXXPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00961 | Tritrp-W678hW | VRRFPXXXPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00962 | Tritrp-W6hW | VRRFPXWWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00966 | Tritrp-W6A | VRRFPAWWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00967 | Tritrp-W678F | VRRFPFFFPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00968 | Tritrp-W7hW | VRRFPWXWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00970 | Tritrp-W7A | VRRFPWAWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00971 | Tritrp-W8hW | VRRFPWWXPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00972 | Tritrp-W8A | VRRFPWWAPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00973 | Tritrp-P9A | VRRFPWWWAFLRR | 13 | porcine cathelicidin peptide |
This work is licensed under a Creative Commons Attribution 4.0 International License.