This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep05035 | Callyaerin D | IIFPXPLXPINAI | 13 | |
| DCTPep05036 | Callyaerin B | IXIILPPLXPII | 12 | |
| DCTPep05037 | Callyaerin A | IXVILPPLXPIFG | 13 | |
| DCTPep05039 | Callyaerin E | LPFFPPVXPIIG | 12 | |
| DCTPep05040 | Callyaerin G | LPPPPLXPFFF | 11 | |
| DCTPep05041 | Callyaerin F | VPVFPXPLF | 9 | |
| DCTPep05042 | Callyaerin H | VPVFPPLXPI | 10 | |
| DCTPep05043 | YCNIHQVCHYAQRNDRSYWL | 20 | Synthetic | |
| DCTPep05044 | Hexastatin-2 | YCNINEVCHYARRNDKSYWL | 20 | Homo sapiens (α6 CIV) |
| DCTPep05045 | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWK | 35 | Synthetic | |
| DCTPep05046 | msurvivin | YLKNYRIATFKNWPF | 15 | Synthetic |
| DCTPep05047 | SEQ ID NO:48 of US7365159B2 | YPYDVPDYASL | 11 | Synthetic |
| DCTPep05048 | TL1AL72-L251(rev) | YRIPIVRRLQRR | 12 | Synthetic |
| DCTPep05049 | KV11 | YTMNPRKLFDY | 11 | Kringle 5 |
| DCTPep05050 | TL1AV84-L251(fw) | YTYGLCTSSR | 10 | Synthetic |
| DCTPep05051 | Tat (43-60) | LGISYGRKKRRQRRRPPQ | 18 | Protein derived |
| DCTPep05052 | Tat (37-60) | FITKALGISYGRKKRRQRRRPPQ | 23 | Protein derived |
| DCTPep05053 | Tat (37-53) | FITKALGISYGRKKRR | 16 | Protein derived |
| DCTPep05054 | Tat (49-56) | RKKRRQRR | 8 | Protein derived |
| DCTPep05055 | Tat (49-55) | RKKRRQR | 7 | Protein derived |
| DCTPep05056 | Tat (50-57) | KKRRQRRR | 8 | Protein derived |
| DCTPep05057 | Tat (51-57) | KRRQRRR | 7 | Protein derived |
| DCTPep05058 | D-Tat (49-57) | rkkrrqrrr | 9 | Protein derived |
| DCTPep05059 | Retro - Tat (57-49) | RRRQRRKKR | 9 | Protein derived |
| DCTPep05060 | D-Tat (57-49) | rrrqrrkkr | 9 | Protein derived |
| DCTPep05061 | Ala49 substitution mutant of Tat (49-57) | AKKRRQRRR | 9 | Protein derived |
| DCTPep05062 | Ala50 substitution mutant of Tat (49-57) | RAKRRQRRR | 9 | Protein derived |
| DCTPep05063 | Ala51 substitution mutant of Tat (49-57) | RKARRQRRR | 9 | Protein derived |
| DCTPep05064 | Ala52 substitution mutant of Tat (49-57) | RKKARQRRR | 9 | Protein derived |
| DCTPep05065 | Ala53 substitution mutant of Tat (49-57) | RKKRAQRRR | 9 | Protein derived |
This work is licensed under a Creative Commons Attribution 4.0 International License.