| DCTPep04836 | 
                aa 128-167; partial loop-4+loop-5+loop-6 | 
                CKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFAC | 
                40 | 
                Synthetic | 
               
            
 
                | DCTPep04837 | 
                AA 128-175; loop-4+loop-5+loop-6 | 
                CKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSC | 
                48 | 
                Synthetic | 
               
            
 
                | DCTPep04838 | 
                aa 146-167; loop-5 | 
                CLWMDWVTEKNINGHQAKFFAC | 
                22 | 
                Synthetic | 
               
            
 
                | DCTPep04843 | 
                 | 
                DDDDKRAGSPSGGPFCALARQPLTGSPPNERAFFCSSRDV | 
                40 | 
                Synthetic | 
               
            
 
                | DCTPep04854 | 
                Loop 6 | 
                ECLWMDWVTEKNINGHQAKFFACI | 
                24 | 
                Synthetic | 
               
            
 
                | DCTPep04893 | 
                 | 
                IARALFEKKV | 
                10 | 
                Synthetic | 
               
            
 
                | DCTPep04895 | 
                 | 
                INEFLERSGIPRQRNQ | 
                16 | 
                Synthetic | 
               
            
 
                | DCTPep04896 | 
                 | 
                INGSLDKRLLPDVET | 
                15 | 
                Synthetic | 
               
            
 
                | DCTPep04897 | 
                 | 
                INGSLDKRVQDCYHG | 
                15 | 
                Synthetic | 
               
            
 
                | DCTPep04898 | 
                 | 
                INLEACLGRTLMD | 
                13 | 
                Synthetic | 
               
            
 
                | DCTPep04899 | 
                 | 
                INLEACLKRGRT | 
                12 | 
                Synthetic | 
               
            
 
                | DCTPep04908 | 
                aa 129-138; partial loop-4+loop-5 | 
                KITRCPMIPC | 
                10 | 
                Synthetic | 
               
            
 
                | DCTPep04909 | 
                aa 129-145; partial loop-4+loop-5 | 
                KITRCPMIPCYISSPDE | 
                17 | 
                Synthetic | 
               
            
 
                | DCTPep04933 | 
                 | 
                LVPRGSRAGSPSGGPFCALARQPLTGARLMSGLFFALHET | 
                40 | 
                Synthetic | 
               
            
 
                | DCTPep04944 | 
                 | 
                MFSPILSLEIILALATLQSVFAQPVICTTVGSAAEGS | 
                37 | 
                Synthetic | 
               
            
 
                | DCTPep04968 | 
                 | 
                RAGSPSGGPFCALARQPLTGSPPNERAFFCSSRDV | 
                35 | 
                Synthetic | 
               
            
 
                | DCTPep04969 | 
                 | 
                RCRLAERRQIAK | 
                12 | 
                Synthetic | 
               
            
 
                | DCTPep05002 | 
                 | 
                SVSGGGHHHHHHGGG | 
                15 | 
                Synthetic | 
               
            
 
                | DCTPep05003 | 
                synVB1 | 
                SVSRAGSPSGGPFC | 
                14 | 
                Synthetic | 
               
            
 
                | DCTPep05018 | 
                Loop 5 | 
                TRCPMIPCYI | 
                10 | 
                Synthetic | 
               
            
 
                | DCTPep05047 | 
                SEQ ID NO:48 of US7365159B2 | 
                YPYDVPDYASL | 
                11 | 
                Synthetic | 
               
            
 
                | DCTPep05051 | 
                Tat (43-60) | 
                LGISYGRKKRRQRRRPPQ | 
                18 | 
                Protein derived | 
               
            
 
                | DCTPep05054 | 
                Tat (49-56) | 
                RKKRRQRR | 
                8 | 
                Protein derived | 
               
            
 
                | DCTPep05055 | 
                Tat (49-55) | 
                RKKRRQR | 
                7 | 
                Protein derived | 
               
            
 
                | DCTPep05056 | 
                Tat (50-57) | 
                KKRRQRRR | 
                8 | 
                Protein derived | 
               
            
 
                | DCTPep05057 | 
                Tat (51-57) | 
                KRRQRRR | 
                7 | 
                Protein derived | 
               
            
 
                | DCTPep05058 | 
                D-Tat (49-57) | 
                rkkrrqrrr | 
                9 | 
                Protein derived | 
               
            
 
                | DCTPep05059 | 
                Retro - Tat (57-49) | 
                RRRQRRKKR | 
                9 | 
                Protein derived | 
               
            
 
                | DCTPep05060 | 
                D-Tat (57-49) | 
                rrrqrrkkr | 
                9 | 
                Protein derived | 
               
            
 
                | DCTPep05061 | 
                Ala49 substitution mutant of Tat (49-57) | 
                AKKRRQRRR | 
                9 | 
                Protein derived |