This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep06868 | 2D3(G45-N52) | RRRRRRRRGGGLTIYFYN | 18 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06869 | 2D5(G45-Y51) | RRRRRRRRGGGLTIYFY | 17 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06870 | 6E(V116-M135) | RRRRRRRRGGVVELRVPTDLTLLPGHLYMM | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06871 | 6F (I113-P122) | RRRRRRRRGGILTVVELRVP | 20 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06872 | IWDTIEK | 7 | Snake venom of N. kaouthia | |
| DCTPep06873 | WWSDHR | 6 | Snake venom of N. kaouthia | |
| DCTPep06874 | B1AW | FLPLLAGLAANFLPQIICKIARKC | 24 | Skin secretions of the Wuyi torrent frog, Amolops wuyiensis (A. wuyiensisi) |
| DCTPep06875 | B1AW-K | FLPLLAGLAANFLPKIICKIARKC | 24 | Synthetic (derived from B1AW) |
| DCTPep06876 | PMAP-NC | RIIDRLWLVRRPOKPKFVLVWVL | 23 | Synthetic (derived from PMAP-23) |
| DCTPep06877 | MGS4_V8 (monomer) | FHAVPQSFYT | 10 | Synthetic (derived from MGS4) |
| DCTPep06878 | MGS4_V9 (dimer) | FHAVPQSFYT | 10 | Synthetic (derived from MGS4) |
| DCTPep06879 | MGS4_V10 (tetramer) | FHAVPQSFYT | 10 | Synthetic (derived from MGS4) |
| DCTPep06880 | ALA-A2 | KLWCKSSQVPQSR | 13 | Synthetic |
| DCTPep06881 | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | 37 | Synthetic | |
| DCTPep06882 | AC-CCSP-1-o | GⓍFAVⓍKKVASVIKGL | 16 | Synthetic |
| DCTPep06883 | AC-CCSP-1-m | GⓍFAVⓍKKVASVIKGL | 16 | Synthetic |
| DCTPep06884 | AC-CCSP-1-p | GⓍFAVⓍKKVASVIKGL | 16 | Synthetic |
| DCTPep06885 | AC-CCSP-2-o | GLFAⓍIKKⓍASVIKGL | 16 | Synthetic |
| DCTPep06886 | AC-CCSP-2-m | GLFAⓍIKKⓍASVIKGL | 16 | Synthetic |
| DCTPep06887 | AC-CCSP-2-p | GLFAⓍIKKⓍASVIKGL | 16 | Synthetic |
| DCTPep06888 | AC-CCSP-3-o | GLFAVⓍKKVⓍSVIKGL | 16 | Synthetic |
| DCTPep06889 | AC-CCSP-3-m | GLFAVⓍKKVⓍSVIKGL | 16 | Synthetic |
| DCTPep06890 | AC-CCSP-3-p | GLFAVⓍKKVⓍSVIKGL | 16 | Synthetic |
| DCTPep06891 | AC-CCSP-4-o | GLFAVIKKⓍASVⓍKGL | 16 | Synthetic |
| DCTPep06892 | AC-CCSP-4-m | GLFAVIKKⓍASVⓍKGL | 16 | Synthetic |
| DCTPep06893 | AC-CCSP-4-p | GLFAVIKKⓍASVⓍKGL | 16 | Synthetic |
| DCTPep06894 | AC-CCSP-5-Dp | GLFAVⓍKKVASVⓍKGL | 16 | Synthetic |
| DCTPep06895 | Longicalycinin A analogue, cyclo-[Gly-Tyr-Pro-Phe-Val] | GYPFV | 5 | Synthetic |
| DCTPep06896 | Longicalycinin A analogue, cyclo-[Leu-Tyr-Pro-Phe-Ala] | LYPFA | 5 | Synthetic |
| DCTPep06897 | Longicalycinin A analogue, cyclo-[Gly-Tyr-Pro-Phe-Ala] | GYPFA | 5 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.