Peptide Libraray

DCTPep ID	Peptide Name	Sequence	Sequence Length	C terminal
DCTPep05035	Callyaerin D	IIFPXPLXPINAI	13	Amidation
DCTPep05036	Callyaerin B	IXIILPPLXPII	12	X(2)=4-HYP; X(9)=DAA
DCTPep05037	Callyaerin A	IXVILPPLXPIFG	13	X(2)=4-HYP; X(9)=DAA
DCTPep05039	Callyaerin E	LPFFPPVXPIIG	12	Amidation
DCTPep05040	Callyaerin G	LPPPPLXPFFF	11	Amidation
DCTPep05041	Callyaerin F	VPVFPXPLF	9	Amidation
DCTPep05042	Callyaerin H	VPVFPPLXPI	10	Amidation
DCTPep05043		YCNIHQVCHYAQRNDRSYWL	20	Free
DCTPep05044	Hexastatin-2	YCNINEVCHYARRNDKSYWL	20	Free
DCTPep05045		YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWK	35	Free
DCTPep05046	msurvivin	YLKNYRIATFKNWPF	15	Free
DCTPep05047	SEQ ID NO:48 of US7365159B2	YPYDVPDYASL	11	Free
DCTPep05048	TL1AL72-L251(rev)	YRIPIVRRLQRR	12	Free
DCTPep05049	KV11	YTMNPRKLFDY	11	Free
DCTPep05050	TL1AV84-L251(fw)	YTYGLCTSSR	10	Free
DCTPep05051	Tat (43-60)	LGISYGRKKRRQRRRPPQ	18	Fluorescein maleimide
DCTPep05052	Tat (37-60)	FITKALGISYGRKKRRQRRRPPQ	23	Fluorescein maleimide
DCTPep05053	Tat (37-53)	FITKALGISYGRKKRR	16	Fluorescein maleimide
DCTPep05054	Tat (49-56)	RKKRRQRR	8	Free
DCTPep05055	Tat (49-55)	RKKRRQR	7	Free
DCTPep05056	Tat (50-57)	KKRRQRRR	8	Free
DCTPep05057	Tat (51-57)	KRRQRRR	7	Free
DCTPep05058	D-Tat (49-57)	rkkrrqrrr	9	Free
DCTPep05059	Retro - Tat (57-49)	RRRQRRKKR	9	Free
DCTPep05060	D-Tat (57-49)	rrrqrrkkr	9	Free
DCTPep05061	Ala49 substitution mutant of Tat (49-57)	AKKRRQRRR	9	Free
DCTPep05062	Ala50 substitution mutant of Tat (49-57)	RAKRRQRRR	9	Free
DCTPep05063	Ala51 substitution mutant of Tat (49-57)	RKARRQRRR	9	Free
DCTPep05064	Ala52 substitution mutant of Tat (49-57)	RKKARQRRR	9	Free
DCTPep05065	Ala53 substitution mutant of Tat (49-57)	RKKRAQRRR	9	Free