This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01155 | SEQ ID NO 32 from EP1783140A3 | WRP | 3 | Screen of phage display peptide library |
| DCTPep01156 | SEQ ID NO 30 from EP1783140A3 | WRPA | 4 | Screen of phage display peptide library |
| DCTPep01157 | SEQ ID NO 31 from EP1783140A3 | WRPW | 4 | Screen of phage display peptide library |
| DCTPep01158 | SEQ ID NO: 2 from EP2716297B1 | LNQEDARKSE | 10 | Screen of phage display peptide library |
| DCTPep01159 | SEQ ID NO: 3 from EP2716297B1 | LNQEEARKSE | 10 | Screen of phage display peptide library |
| DCTPep01160 | SEQ ID NO: 1 from EP2716297B1 | LNQESARKSE | 10 | Screen of phage display peptide library |
| DCTPep01161 | D-Glu-Fniii14 | TeATITGLEPGTEYTITVIAL | 21 | Not available |
| DCTPep01162 | Not available | TEATITGLEPGTEYTITVIAL | 21 | Not available |
| DCTPep01163 | hBD3-3 | GKCSTRGRKCCRRKK | 15 | Not available |
| DCTPep01164 | hBD3-3 M1 | GKCSTRGRKCMRRKK | 15 | Not available |
| DCTPep01165 | hBD3-3 M2 | GKCSTRGRKMCRRKK | 15 | Not available |
| DCTPep01166 | PBP-1 | CLQKTPKQC | 9 | Not available |
| DCTPep01167 | PBP-2 | CVRARTR | 7 | Not available |
| DCTPep01168 | v6Pep-2 | CNEWQLKSC | 9 | Screen of phage display peptide library |
| DCTPep01169 | v6Pep-1 | CNLNTIDTC | 9 | Screen of phage display peptide library |
| DCTPep01170 | HDH-LGBP-A2 | WLWKAIWKLLK | 11 | Not available |
| DCTPep01171 | HDH-LGBP-A1 | WLWKAIWKLLT | 11 | Not available |
| DCTPep01172 | PvVCP | FWPGLILKGLGAL | 13 | Not available |
| DCTPep01173 | PvVespk | GRPPGFSPFRSG | 12 | Not available |
| DCTPep01174 | p53 TAD(50-54) Ala-substituted peptide | AEQAA | 5 | p57 protein |
| DCTPep01175 | p53 TAD(50-54) | IEQWF | 5 | p53 protein |
| DCTPep01176 | p53 TAD(50-54) Trp-substituted peptide | WEQWW | 5 | p61 protein |
| DCTPep01177 | Not available | IKWKAILDAVKKVL | 14 | Not available |
| DCTPep01178 | ACP52C | NYPQRPCRGDKGPDC | 15 | Not available |
| DCTPep01179 | Ⅰ | XPAXXFXPAXXLXXLXXLX | 19 | Peptaibols |
| DCTPep01180 | Ⅱ | XPAXXFXPAXXLXXLXXLX | 19 | Peptaibols |
| DCTPep01181 | B5 | GAVPCGESCVYLPCLTTVVGCSCQNSVCYHN | 31 | Hedyotis biflora |
| DCTPep01182 | B6 | GAVPCGETCVYLPCITAAIGCSCQNKVCYRD | 31 | Hedyotis biflora |
| DCTPep01183 | B8 | GIPCGESCAFLPCLTSLLGCTCQNKVCYRD | 30 | Hedyotis biflora |
| DCTPep01184 | B7 | GISCAETCVLLPCLSSVIGCTCQNKRCYKN | 30 | Hedyotis biflora |
This work is licensed under a Creative Commons Attribution 4.0 International License.