This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01826 | N10K | NQVSLTCLVK | 10 | AMPs |
| DCTPep01827 | T11F | TCRVDHRGLTF | 11 | AMPs |
| DCTPep01828 | MB30 | GQVWEATATVNAIRGSVTPAVSQFNARTAD | 30 | Derived from the MPT63 secreted protein |
| DCTPep01829 | TG20 | NHFTLKCPKTALTEPPTLAY | 20 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
| DCTPep01830 | TG23 | TAGIKLTVPIEKFPVTTQTFWG | 22 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
| DCTPep01831 | PIER4 (Tat-PIER1) | GRKKRRQRRRPQ | 12 | AMPs |
| DCTPep01832 | IL4RPep1KLA | CRKRLDRCGGGKLAKLAKKLAKLAK | 25 | Synthetics |
| DCTPep01833 | RPS6 subunit anticancer peptide | ISGGNDKQGFPM | 12 | Synthetics |
| DCTPep01834 | ANS-1 | AVPSP | 5 | Synthetics |
| DCTPep01835 | ANS-2 | AVPSPPPAS | 9 | Synthetics |
| DCTPep01836 | FGF2 derived peptides | KRTGQYKLGSKT | 12 | API13 derived peptides |
| DCTPep01837 | API5 derived peptides | LEDVTGEEF | 9 | API5 derived peptides |
| DCTPep01846 | CP-EPS8-NLS | GRKKRRQRRRPQSKRKKNKKGKRK | 24 | Derived from the NLS of EPS8 |
| DCTPep01847 | MIA-602 | YADAIFTNSYRKVLGQLSARKLLQDIMSR | 29 | Synthetic |
| DCTPep01848 | MIA-606 | YADAIFTXSYRKVLGQLSARKLLQDIMSR | 29 | Synthetic |
| DCTPep01850 | JMR-132 | YADAIFTAXXHKVLGQLSAHKLLQDIMSR | 29 | Synthetic |
| DCTPep01852 | Amurin-2a [L4K] | FLPKLLAGLPSFLCLVFKKC | 20 | Synthetic |
| DCTPep01853 | Amurin-2a [S11K] | FLPLLLAGLPKFLCLVFKKC | 20 | Synthetic |
| DCTPep01854 | K(RW)3 | KRWRWRW | 7 | Synthetic |
| DCTPep01855 | Desotamide B [V2I] | NIlLWG | 6 | Synthetic |
| DCTPep01856 | Wollamide B [D-Orn6Orn] | NVlLWX | 6 | Synthetic |
| DCTPep01860 | KFAK(1) | KFAK | 4 | Synthetic |
| DCTPep01861 | KFAK(2) | KFAKKFAK | 8 | Synthetic |
| DCTPep01862 | KFAK(3) | KFAKKFAKKFAK | 12 | Synthetic |
| DCTPep01863 | KFAK(4) | KFAKKFAKKFAKKFAK | 16 | Synthetic |
| DCTPep01864 | KFAK(5) | KFAKKFAKKFAKKFAKKFAK | 20 | Synthetic |
| DCTPep01865 | KFAK(6) | KFAKKFAKKFAKKFAKKFAKKFAK | 24 | Synthetic |
| DCTPep01866 | KFAK(7) | KFAKKFAKKFAKKFAKKFAKKFAKKFAK | 28 | Synthetic |
| DCTPep01867 | KFAK(8) | KFAKKFAKKFAKKFAKKFAKKFAKKFAKKFAK | 32 | Synthetic |
| DCTPep01868 | RFAR(6) | RFARRFARRFARRFARRFARRFAR | 24 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.