This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00712 | B7 | KKLFKKILKY | 10 | antimicrobial peptides |
| DCTPep00713 | BP100 | KKLFKKILKYL | 11 | antimicrobial peptides |
| DCTPep00714 | B1 | KKLFKKILKYLK | 12 | antimicrobial peptides |
| DCTPep00715 | B2 | KKLFKKILKYLKK | 13 | antimicrobial peptides |
| DCTPep00716 | B3 | KKLFKKILKYLKKL | 14 | antimicrobial peptides |
| DCTPep00717 | B9 | KLKKLFKKILKY | 12 | antimicrobial peptides |
| DCTPep00718 | B8 | LKKLFKKILKY | 11 | antimicrobial peptides |
| DCTPep00719 | B4 | LKKLFKKILKYL | 12 | antimicrobial peptides |
| DCTPep00720 | B5 | LKKLFKKILKYLK | 13 | antimicrobial peptides |
| DCTPep00721 | B6 | LKKLFKKILKYLKK | 14 | antimicrobial peptides |
| DCTPep00723 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | 27 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00724 | Bombinin H-BO | IIGPVLGLIGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00725 | D Tachyplesin [C3,7,12,16Del] | kwfrvyrGiyrrr | 13 | Synthetic |
| DCTPep00726 | Tachyplesin [C3,7,12,16Del] | KWFRVYRGIYRRR | 13 | Synthetic |
| DCTPep00727 | Reverse D Tachyplesin [C3,7,12,16Del] | rrryiGryvrfwk | 13 | Synthetic |
| DCTPep00728 | Reverse Tachyplesin [C3,7,12,16Del] | RRRYIGRYVRFWK | 13 | Synthetic |
| DCTPep00729 | I-3 | LVKRFKKFFRKLKKSVLL | 18 | cationic host defense peptides |
| DCTPep00730 | I-7 | LVRRFRRFFRRLRRSVLL | 18 | cationic host defense peptides |
| DCTPep00731 | I-8 | VKRFKKFFLKLKSV | 14 | cationic host defense peptides |
| DCTPep00733 | I-1 | VKRFKKFFRKLKKSVL | 16 | cationic host defense peptides |
| DCTPep00734 | I-2 | VKRFKKFFRKLKKSVLL | 17 | cationic host defense peptides |
| DCTPep00735 | I-9 | VKRFKLFFRKLKSV | 14 | cationic host defense peptides |
| DCTPep00736 | I-11 | VRRFRLFFRRLRRSV | 15 | cationic host defense peptides |
| DCTPep00737 | I-10 | VRRFRRFFLRLRRSV | 15 | cationic host defense peptides |
| DCTPep00738 | I-4 | VRRFRRFFRRLRRSV | 15 | cationic host defense peptides |
| DCTPep00739 | I-5 | VRRFRRFFRRLRRSVL | 16 | cationic host defense peptides |
| DCTPep00740 | I-6 | VRRFRRFFRRLRRSVLL | 17 | cationic host defense peptides |
| DCTPep00741 | Tricyclon-A | GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN | 33 | Viola odorata |
| DCTPep00744 | Cyclotide cter-E | GIPCAESCVWIPCTVTALLGCSCKDKVCYLD | 31 | Clitoria ternatea |
| DCTPep00745 | Cycloviolacin O3 | GIPCGESCVWIPCLTSAIGCSCKSKVCYRN | 30 | Viola odorata |
This work is licensed under a Creative Commons Attribution 4.0 International License.