This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00506 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | 27 | Synthetic |
| DCTPep00507 | Toxin F-VIII | MICYSHKTPQPSATITCEEKTCYKKSVRKLPAIVAGRGCGCPSKEMLVAIHCCRSDKCNE | 60 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DCTPep00508 | Toxin C13S1C1 | RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN | 59 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DCTPep00509 | 3-OH-C16-KKKK | KKKK | 4 | Synthetic |
| DCTPep00510 | C16-KKKK | KKKK | 4 | Synthetic |
| DCTPep00511 | Hymenochirin-1Pa | LKLSPKTKDTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00512 | [D9K]Hymenochirin-1Pa | LKLSPKTKKTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00514 | Mastoparan | INLKALAALAKKIL | 14 | Vespula lewisii |
| DCTPep00515 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | 27 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00516 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00517 | B1-Ala | VKRFKKFFRKLKKAV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DCTPep00518 | B1-Asp | VKRFKKFFRKLKKDV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DCTPep00519 | B1-Glu | VKRFKKFFRKLKKEV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DCTPep00520 | B1-Phe | VKRFKKFFRKLKKFV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DCTPep00521 | B1-Gly | VKRFKKFFRKLKKGV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B2 |
| DCTPep00522 | B1-His | VKRFKKFFRKLKKHV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DCTPep00523 | B1-Lys | VKRFKKFFRKLKKKV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DCTPep00524 | B1-Leu | VKRFKKFFRKLKKLV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DCTPep00525 | B1-Gln | VKRFKKFFRKLKKQV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DCTPep00526 | B1-Arg | VKRFKKFFRKLKKRV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DCTPep00527 | B1 | VKRFKKFFRKLKKSV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DCTPep00528 | B1-Thr | VKRFKKFFRKLKKTV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DCTPep00529 | B1-Val | VKRFKKFFRKLKKVV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DCTPep00530 | WKX | WKX | 3 | Synthetic |
| DCTPep00531 | GN-11 | IKWKRWWWR | 9 | Synthetic |
| DCTPep00532 | GN-8 | IWKRWWWKR | 9 | Synthetic |
| DCTPep00533 | GN-5 | KKRWWWWWR | 9 | Synthetic |
| DCTPep00534 | GN-12 | KWWKIWRWR | 9 | Synthetic |
| DCTPep00535 | GN-3 | KWWRWRRWW | 9 | Synthetic |
| DCTPep00536 | GN-9 | RIWKIWWKR | 9 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.