This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep06852 | Tric-COOH | XGLXGGLXGIL | 11 | Ascomycetes (Tric) |
| DCTPep06853 | Ac-Tric | XGLXGGLXGIX | 11 | Ascomycetes (Tric) |
| DCTPep06854 | Tric[K2] | XKLXGGLXGIX | 11 | Ascomycetes (Tric) |
| DCTPep06855 | Tric[K2]-OMe | XKLXGGLXGIL | 11 | Ascomycetes (Tric) |
| DCTPep06856 | Tric[K2]-COOH | XKLXGGLXGIL | 11 | Ascomycetes (Tric) |
| DCTPep06857 | Tric[K6] | XGLXGKLXGIX | 11 | Ascomycetes (Tric) |
| DCTPep06858 | Tric[K6]-OMe | XGLXGKLXGIL | 11 | Ascomycetes (Tric) |
| DCTPep06859 | Tric[K9] | XGLXGGLXKIX | 11 | Ascomycetes (Tric) |
| DCTPep06860 | Tric[K9]-OMe | XGLXGGLXKIL | 11 | Ascomycetes (Tric) |
| DCTPep06861 | Caerin 1.1 Modification | GLLSVLGSVAKHVLGHVVGVIAEHL | 25 | Synthetic |
| DCTPep06862 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06863 | #6(M108-L127) | RRRRRRRRGGMWKGFILTVVELRVPTDLTL | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06864 | 2A(F39-Q58) | RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06865 | 2C(Q44-Q58) | RRRRRRRRGGQGLTIYFYNSNRDFQ | 25 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06866 | 2D(Q44-R55) | RRRRRRRRGGQGLTIYFYNSNR | 22 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06867 | 2D2(Q44-Y51) | RRRRRRRRGGQGLTIYFY | 18 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06868 | 2D3(G45-N52) | RRRRRRRRGGGLTIYFYN | 18 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06869 | 2D5(G45-Y51) | RRRRRRRRGGGLTIYFY | 17 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06870 | 6E(V116-M135) | RRRRRRRRGGVVELRVPTDLTLLPGHLYMM | 30 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06871 | 6F (I113-P122) | RRRRRRRRGGILTVVELRVP | 20 | Synthetic (STAP-2 PH domain–derived peptide) |
| DCTPep06872 | IWDTIEK | 7 | Snake venom of N. kaouthia | |
| DCTPep06873 | WWSDHR | 6 | Snake venom of N. kaouthia | |
| DCTPep06874 | B1AW | FLPLLAGLAANFLPQIICKIARKC | 24 | Skin secretions of the Wuyi torrent frog, Amolops wuyiensis (A. wuyiensisi) |
| DCTPep06875 | B1AW-K | FLPLLAGLAANFLPKIICKIARKC | 24 | Synthetic (derived from B1AW) |
| DCTPep06876 | PMAP-NC | RIIDRLWLVRRPOKPKFVLVWVL | 23 | Synthetic (derived from PMAP-23) |
| DCTPep06877 | MGS4_V8 (monomer) | FHAVPQSFYT | 10 | Synthetic (derived from MGS4) |
| DCTPep06878 | MGS4_V9 (dimer) | FHAVPQSFYT | 10 | Synthetic (derived from MGS4) |
| DCTPep06879 | MGS4_V10 (tetramer) | FHAVPQSFYT | 10 | Synthetic (derived from MGS4) |
| DCTPep06880 | ALA-A2 | KLWCKSSQVPQSR | 13 | Synthetic |
| DCTPep06881 | TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC | 37 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.