Result entries:  5612
DCTPep ID Peptide Name Sequence Sequence Length Origin
DCTPep06852 Tric-COOH XGLXGGLXGIL 11 Ascomycetes (Tric)
DCTPep06853 Ac-Tric XGLXGGLXGIX 11 Ascomycetes (Tric)
DCTPep06854 Tric[K2] XKLXGGLXGIX 11 Ascomycetes (Tric)
DCTPep06855 Tric[K2]-OMe XKLXGGLXGIL 11 Ascomycetes (Tric)
DCTPep06856 Tric[K2]-COOH XKLXGGLXGIL 11 Ascomycetes (Tric)
DCTPep06857 Tric[K6] XGLXGKLXGIX 11 Ascomycetes (Tric)
DCTPep06858 Tric[K6]-OMe XGLXGKLXGIL 11 Ascomycetes (Tric)
DCTPep06859 Tric[K9] XGLXGGLXKIX 11 Ascomycetes (Tric)
DCTPep06860 Tric[K9]-OMe XGLXGGLXKIL 11 Ascomycetes (Tric)
DCTPep06861 Caerin 1.1 Modification GLLSVLGSVAKHVLGHVVGVIAEHL 25 Synthetic
DCTPep06862 #2(D33-N52) RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN 30 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06863 #6(M108-L127) RRRRRRRRGGMWKGFILTVVELRVPTDLTL 30 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06864 2A(F39-Q58) RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ 30 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06865 2C(Q44-Q58) RRRRRRRRGGQGLTIYFYNSNRDFQ 25 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06866 2D(Q44-R55) RRRRRRRRGGQGLTIYFYNSNR 22 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06867 2D2(Q44-Y51) RRRRRRRRGGQGLTIYFY 18 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06868 2D3(G45-N52) RRRRRRRRGGGLTIYFYN 18 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06869 2D5(G45-Y51) RRRRRRRRGGGLTIYFY 17 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06870 6E(V116-M135) RRRRRRRRGGVVELRVPTDLTLLPGHLYMM 30 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06871 6F (I113-P122) RRRRRRRRGGILTVVELRVP 20 Synthetic (STAP-2 PH domain–derived peptide)
DCTPep06872 IWDTIEK 7 Snake venom of N. kaouthia
DCTPep06873 WWSDHR 6 Snake venom of N. kaouthia
DCTPep06874 B1AW FLPLLAGLAANFLPQIICKIARKC 24 Skin secretions of the Wuyi torrent frog, Amolops wuyiensis (A. wuyiensisi)
DCTPep06875 B1AW-K FLPLLAGLAANFLPKIICKIARKC 24 Synthetic (derived from B1AW)
DCTPep06876 PMAP-NC RIIDRLWLVRRPOKPKFVLVWVL 23 Synthetic (derived from PMAP-23)
DCTPep06877 MGS4_V8 (monomer) FHAVPQSFYT 10 Synthetic (derived from MGS4)
DCTPep06878 MGS4_V9 (dimer) FHAVPQSFYT 10 Synthetic (derived from MGS4)
DCTPep06879 MGS4_V10 (tetramer) FHAVPQSFYT 10 Synthetic (derived from MGS4)
DCTPep06880 ALA-A2 KLWCKSSQVPQSR 13 Synthetic
DCTPep06881 TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC 37 Synthetic
<< < 184 185 186 187 188 >>

DCTPep is developed by Dr.Zheng's team.