Result entries:  3334
DCTPep ID Peptide Name Sequence Sequence Length Origin
DCTPep00505 C7A-Δ KILRGVAKKIMRTFLRRILTGKK 23 Synthetic
DCTPep00506 C7A-D21K KILRGVAKKIMRTFLRRISKKILTGKK 27 Synthetic
DCTPep00507 Toxin F-VIII MICYSHKTPQPSATITCEEKTCYKKSVRKLPAIVAGRGCGCPSKEMLVAIHCCRSDKCNE 60 venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
DCTPep00508 Toxin C13S1C1 RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN 59 venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
DCTPep00509 3-OH-C16-KKKK KKKK 4 Synthetic
DCTPep00510 C16-KKKK KKKK 4 Synthetic
DCTPep00511 Hymenochirin-1Pa LKLSPKTKDTLKKVLKGAIKGAIAIASMA 29 skin secretions of the frog Pseudhymenochirus merlini (Pipidae)
DCTPep00512 [D9K]Hymenochirin-1Pa LKLSPKTKKTLKKVLKGAIKGAIAIASMA 29 skin secretions of the frog Pseudhymenochirus merlini (Pipidae)
DCTPep00513 [D9k]Hymenochirin-1Pa LKLSPKTKkTLKKVLKGAIKGAIAIASMA 29 skin secretions of the frog Pseudhymenochirus merlini (Pipidae)
DCTPep00514 Mastoparan INLKALAALAKKIL 14 Vespula lewisii
DCTPep00515 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE 27 skin secretions of the frog Pseudhymenochirus merlini (Pipidae)
DCTPep00516 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS 29 skin secretions of the frog Pseudhymenochirus merlini (Pipidae)
DCTPep00517 B1-Ala VKRFKKFFRKLKKAV 15 Cathelicidin-BF15 C-terminal amidated derivative B1
DCTPep00518 B1-Asp VKRFKKFFRKLKKDV 15 Cathelicidin-BF15 C-terminal amidated derivative B3
DCTPep00519 B1-Glu VKRFKKFFRKLKKEV 15 Cathelicidin-BF15 C-terminal amidated derivative B3
DCTPep00520 B1-Phe VKRFKKFFRKLKKFV 15 Cathelicidin-BF15 C-terminal amidated derivative B1
DCTPep00521 B1-Gly VKRFKKFFRKLKKGV 15 Cathelicidin-BF15 C-terminal amidated derivative B2
DCTPep00522 B1-His VKRFKKFFRKLKKHV 15 Cathelicidin-BF15 C-terminal amidated derivative B3
DCTPep00523 B1-Lys VKRFKKFFRKLKKKV 15 Cathelicidin-BF15 C-terminal amidated derivative B3
DCTPep00524 B1-Leu VKRFKKFFRKLKKLV 15 Cathelicidin-BF15 C-terminal amidated derivative B1
DCTPep00525 B1-Gln VKRFKKFFRKLKKQV 15 Cathelicidin-BF15 C-terminal amidated derivative B3
DCTPep00526 B1-Arg VKRFKKFFRKLKKRV 15 Cathelicidin-BF15 C-terminal amidated derivative B3
DCTPep00527 B1 VKRFKKFFRKLKKSV 15 Cathelicidin-BF15 C-terminal amidated derivative B1
DCTPep00528 B1-Thr VKRFKKFFRKLKKTV 15 Cathelicidin-BF15 C-terminal amidated derivative B3
DCTPep00529 B1-Val VKRFKKFFRKLKKVV 15 Cathelicidin-BF15 C-terminal amidated derivative B1
DCTPep00530 WKX WKX 3 Synthetic
DCTPep00532 GN-8 IWKRWWWKR 9 Synthetic
DCTPep00533 GN-5 KKRWWWWWR 9 Synthetic
DCTPep00534 GN-12 KWWKIWRWR 9 Synthetic
DCTPep00535 GN-3 KWWRWRRWW 9 Synthetic
<< < 13 14 15 16 17 >>

DCTPep is developed by Dr.Zheng's team.