This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00764 | [G1K,K8R]cGm | KCRRLCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00765 | [G1K,L5Y,K8R]cGm | KCRRYCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00766 | [C/U,G1K,L5Y,K8R]cGm | KURRYUYRQRUVTYURGR | 18 | Redesigned Spider Peptide |
| DCTPep00767 | Cyclic Gomesin [PYA1K;C2,6,11,15SeCys;L5Y;K8R] | KXRRYXYRQRXVTYXRGR | 18 | Synthetic |
| DCTPep00768 | Gm | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00769 | Gmred | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00912 | [W2S]cTI | KSCFRVCYRGICYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00913 | [R/K]cTI | KWCFKVCYKGICYKKCKG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00914 | [Y8S-I11S]cTI | KWCFRVCSRGSCYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00915 | [I11F-G18K]cTI | KWCFRVCYRGFCYRRCRK | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00916 | TI | KWCFRVCYRGICYRRCR | 17 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00917 | cTI | KWCFRVCYRGICYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00918 | [G18K]cTI | KWCFRVCYRGICYRRCRK | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00919 | [R17S]cTI | KWCFRVCYRGICYRRCSG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00920 | [R14S]cTI | KWCFRVCYRGICYSRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00921 | [R9S]cTI | KWCFRVCYSGICYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00922 | [R9S-R14S-R17S]cTI | KWCFRVCYSGICYSRCSG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00923 | [F4S-Y13S]cTI | KWCSRVCYRGICSRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00991 | Hyen D | GFPCGESCVYIPCFTAAIGCSCKSKVCYKN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep00992 | Hyen L | GIPCAESCVYIPCTVTALLGCSCSDKVCYN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep00993 | Hyen C | GTHPCQETCVTSTRCSTQGCHCNWPICFKN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep00994 | Hyen E | GVPCGESCVYIPCFTGIINCSCRDKVCYNN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep00995 | Hyen M | SIPCAESCVWIPCTVTALLGCSCSDKVCYN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep02219 | PL-D 1 | WKWLKKWIK | 9 | Synthetic |
| DCTPep02220 | PL-D 2 | ILRWKWRWWRWRR | 13 | Synthetic |
| DCTPep02221 | PL-D 3 | ILPWKWRWWKWRR | 13 | Synthetic |
| DCTPep02222 | PL-D 4 | RWRRKWWWW | 9 | Synthetic |
| DCTPep02223 | PL-D 5 | WRKFWKYLK | 9 | Synthetic |
| DCTPep02224 | PL-D 6 | KRWWKWWRR | 9 | Synthetic |
| DCTPep02225 | PL-D 7 | RRWWKWWWR | 9 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.