This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01808 | Gaegurin peptides SEQID NO: 4 | FLWWLFKWAWK | 11 | Korean frog Rana rugosa |
| DCTPep01812 | GK-1 | KWKLFKKIGIGRLLKRGLRKLLK | 23 | AMPs |
| DCTPep01813 | GK-2 | KWKLFKKIGIGRLLKRGLRKLLKLLR | 26 | AMPs |
| DCTPep01814 | GK-3 | RWRLFKRIGIGRLLKRGLR | 19 | AMPs |
| DCTPep01819 | Not available | KAMKSIAKFIAK | 12 | Synthetics |
| DCTPep01820 | Not available | KGWFKAMKSIAKFIAKEKLKEHL | 23 | Synthetics |
| DCTPep01821 | Not available | KGWFKAMKSIAKFIAKEKMKEHL | 23 | Synthetics |
| DCTPep01822 | Not available | RKGWFKAMKSIAKFIAKEKLKEHL | 24 | Synthetics |
| DCTPep01823 | Not available | WFKAMKSIAKFIAKEKLK | 18 | Synthetics |
| DCTPep01824 | Not available | YRPWGSGSGF | 10 | Synthetics |
| DCTPep01825 | Not available | YRPWGSGSGFG | 11 | Synthetics |
| DCTPep01826 | N10K | NQVSLTCLVK | 10 | AMPs |
| DCTPep01827 | T11F | TCRVDHRGLTF | 11 | AMPs |
| DCTPep01828 | MB30 | GQVWEATATVNAIRGSVTPAVSQFNARTAD | 30 | Derived from the MPT63 secreted protein |
| DCTPep01829 | TG20 | NHFTLKCPKTALTEPPTLAY | 20 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
| DCTPep01830 | TG23 | TAGIKLTVPIEKFPVTTQTFWG | 22 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
| DCTPep01831 | PIER4 (Tat-PIER1) | GRKKRRQRRRPQ | 12 | AMPs |
| DCTPep01832 | IL4RPep1KLA | CRKRLDRCGGGKLAKLAKKLAKLAK | 25 | Synthetics |
| DCTPep01833 | RPS6 subunit anticancer peptide | ISGGNDKQGFPM | 12 | Synthetics |
| DCTPep01834 | ANS-1 | AVPSP | 5 | Synthetics |
| DCTPep01835 | ANS-2 | AVPSPPPAS | 9 | Synthetics |
| DCTPep01836 | FGF2 derived peptides | KRTGQYKLGSKT | 12 | API13 derived peptides |
| DCTPep01837 | API5 derived peptides | LEDVTGEEF | 9 | API5 derived peptides |
| DCTPep01838 | Varv Hm | GLPVCGETCFGGTCNTPGCSCXTWPVCSRN | 30 | Viola arvensis (European field pansy) (Field violet) |
| DCTPep01839 | Varv He | GLPVCGETCFGGTCNTPGCSCXTWPVCSRN | 30 | Viola arvensis (European field pansy) (Field violet) |
| DCTPep01840 | vitri B | GYPICGESCVGGTCNTPGCSCSWPVCTTN | 29 | Viola tricolor |
| DCTPep01841 | vitri C | GLPICGETCVGGTCNTPGCFCTWPVCTRN | 29 | Viola tricolor |
| DCTPep01842 | vitri D | GLPVCGETCFTGSCYTPGCSCNWPVCNRN | 29 | Viola tricolor |
| DCTPep01843 | vitri E | GLPVCGETCVGGTCNTPGCSCSWPVCFRN | 29 | Viola tricolor |
| DCTPep01844 | vitri F | GTLPCGESCVWIPCISSVVGCACKSKVCYKD | 31 | Viola tricolor |
This work is licensed under a Creative Commons Attribution 4.0 International License.